| E|MG>|ry39|t| ||&||||P|R|I|K| &| |HI|K|R|P|rr }u  t}_3^DXXXGHH |2I|K|PRQ:rذTYZXr |.|$|I|K|p t);|s6|ˆO|36|%|M|ôM| 6O|ʆ$|6%| Non-System disk or disk error Replace and press any key when ready IO SYSMSDOS SYSU`  @`! #@%`')+-/1 3@5`79;=?A C@E`GIKMQ S@U`WY[]_a c@e`gikmoq s@u`wy{} @` @ ` @ ` @ ` @ ` ǀ ɠ @ ` ׀ ٠  @` @`!Aa   !Aa!!#A%a')+-/1!3A5a79;=?A!CAEaGIKMOQ!SAUaWY[]_a!cAeagikmoq!sAuawy{}!Aa!Aa!Aa!Aa!Aaǁɡ!Aaׁ١!Aa!Aa " B b  !"!B!b!!!!!"!""#B"%b"'")"+"-"/#1"#3B#5b#7#9#;#=#?$A"$CB$Eb$G$I$K$M$O%Q"%SB%Ub%W%Y%[%]%_&a"&cB&eb&g&i&k&m&o'q"'sB'ub'w'y'{'}'("(B(b((((()")B)b)))))*"*B*b*****+"+B+b+++++,",B,b,ǂ,ɢ,,,-"-B-b-ׂ-٢---.".B.b...../"/B/b/////0#0C0c00 0 0 01#1C1c111112!#2#C2%c2'2)2+2-2/31#33C35c3793;3=3?4A#4CC4Ec4G4I4K4M4O5Q#5SC5Uc5W5Y5[5]5_6a#6cC6ec6g6i6k6m6o7q#7sC7uc7w77{7}78#8C8c888889#9C9c99999:#:C:c:::::;#;C;c;;;;;<##>C>c>>>>>?#?C?c?????@$@D@d@@ @ @ @A$ADAdAAAAAB!$B#DB%dB'B)B+B-B/C1$C3DC5dC7C9C;C=C?DA$DCDDEdDGDIDKDMDOEQ$ESDEUdEWEYE[E]E_Fa$FcDFedFgFiFkFmFoGq$GsDGudGwGyG{G}GH$HDHdHHHHHI$IDIdIIIIIJ$JDJdJJJJJK$KDKdKKKKKL$LDLdLDŽLɤLLLM$MDMdMׄM٤MMMN$NDNdNNNNNO$OdOOOOOP%PEPePP P P PQ%QEQeQQQQQR!%R#ER%eR'R)R+R-R/S1%S3ES5eS7S9S;S=S?TA%TCETEeTGTITKTMTOUQ%USEUUeUWUYU[U]U_Va%VcEVeeVgViVkVmVoWq%WsEWueWwWyW{W}WX%XEXeXXXXXY%YEYeYYYYYZ%ZEZeZZZZZ[%[E[e[[[[[\%\E\e\Dž\ɥ\\\]%]E]e]ׅ]٥]]]^%^E^e^^^^^_%_E_e_____`&`F`f`` ` ` `a&aFafaaaaab!&b#Fb%fb'b)b+b-b/c1&c3Fc5fc7c9c;c=c?dA&dCFdEfdGdIdKdMdOeQ&eSFeUfeWeYe[e]e_fa&fcFfeffgfifkfmfogq&gsFgufgwgyg{g}gh&hFhfhhhhhi&iFifiiiiij&jFjfjjjjjk&kFkfkkkkkl&lFlfldžlɦlllm&mFmfm׆m٦mmmn&nFnfnnnnno&oFofooooop'pGpgpp p p pq'qGqgqqqqqr!'r#Gr%gr'r)r+r-r/s1's3Gs5gs7s9s;s=s?tA'tCGtEgtGtItKtMtOuQ'uSGuUguWuYu[u]u_va'vcGvegvgvivkvmvowq'wsGwugwwwyw{w}wx'xGxgxxxxxy'yGygyyyyyz'zGzgzzzzz{'{G{g{{{{{|'|G|g|LJ|ɧ|||}'}G}g}ׇ}٧}}}~'~G~g~~~~~'Gg(Hh Ȁ (Hhȁ!(#H%h')+Ȃ-/1(3H5h79;ȃ=?A(CHEhGIKȄMOQ(SHUhWY[ȅ]_a(cHehgikȆmoq(sHuhwy{ȇ}(HhȈ舏(Hhȉ艟(HhȊ芯(Hhȋ苿(HhLjɨȌ(Hh׈٨ȍ(Hh爎騎Ȏ(Hhȏ)Ii ɐ  )Iiɑ !)#I%i')+ɒ-/ 1)3I5i79;ɓ=? A)CIEiGIKɔMO Q)SIUiWY[ɕ]_ a)cIeigikɖmo q)sIuiwy{ɗ} )Iiɘ阏 )Iiə陟 )Iiɚ隯 )Iiɛ雿 )Iilj`  @`! #@%`')+-/1 3@5`79;=?A C@E`GIKMQ S@U`WY[]_a c@e`gikmoq s@u`wy{} @` @ ` @ ` @ ` @ ` ǀ ɠ @ ` ׀ ٠  @` @`!Aa   !Aa!!#A%a')+-/1!3A5a79;=?A!CAEaGIKMOQ!SAUaWY[]_a!cAeagikmoq!sAuawy{}!Aa!Aa!Aa!Aa!Aaǁɡ!Aaׁ١!Aa!Aa " B b  !"!B!b!!!!!"!""#B"%b"'")"+"-"/#1"#3B#5b#7#9#;#=#?$A"$CB$Eb$G$I$K$M$O%Q"%SB%Ub%W%Y%[%]%_&a"&cB&eb&g&i&k&m&o'q"'sB'ub'w'y'{'}'("(B(b((((()")B)b)))))*"*B*b*****+"+B+b+++++,",B,b,ǂ,ɢ,,,-"-B-b-ׂ-٢---.".B.b...../"/B/b/////0#0C0c00 0 0 01#1C1c111112!#2#C2%c2'2)2+2-2/31#33C35c3793;3=3?4A#4CC4Ec4G4I4K4M4O5Q#5SC5Uc5W5Y5[5]5_6a#6cC6ec6g6i6k6m6o7q#7sC7uc7w77{7}78#8C8c888889#9C9c99999:#:C:c:::::;#;C;c;;;;;<##>C>c>>>>>?#?C?c?????@$@D@d@@ @ @ @A$ADAdAAAAAB!$B#DB%dB'B)B+B-B/C1$C3DC5dC7C9C;C=C?DA$DCDDEdDGDIDKDMDOEQ$ESDEUdEWEYE[E]E_Fa$FcDFedFgFiFkFmFoGq$GsDGudGwGyG{G}GH$HDHdHHHHHI$IDIdIIIIIJ$JDJdJJJJJK$KDKdKKKKKL$LDLdLDŽLɤLLLM$MDMdMׄM٤MMMN$NDNdNNNNNO$OdOOOOOP%PEPePP P P PQ%QEQeQQQQQR!%R#ER%eR'R)R+R-R/S1%S3ES5eS7S9S;S=S?TA%TCETEeTGTITKTMTOUQ%USEUUeUWUYU[U]U_Va%VcEVeeVgViVkVmVoWq%WsEWueWwWyW{W}WX%XEXeXXXXXY%YEYeYYYYYZ%ZEZeZZZZZ[%[E[e[[[[[\%\E\e\Dž\ɥ\\\]%]E]e]ׅ]٥]]]^%^E^e^^^^^_%_E_e_____`&`F`f`` ` ` `a&aFafaaaaab!&b#Fb%fb'b)b+b-b/c1&c3Fc5fc7c9c;c=c?dA&dCFdEfdGdIdKdMdOeQ&eSFeUfeWeYe[e]e_fa&fcFfeffgfifkfmfogq&gsFgufgwgyg{g}gh&hFhfhhhhhi&iFifiiiiij&jFjfjjjjjk&kFkfkkkkkl&lFlfldžlɦlllm&mFmfm׆m٦mmmn&nFnfnnnnno&oFofooooop'pGpgpp p p pq'qGqgqqqqqr!'r#Gr%gr'r)r+r-r/s1's3Gs5gs7s9s;s=s?tA'tCGtEgtGtItKtMtOuQ'uSGuUguWuYu[u]u_va'vcGvegvgvivkvmvowq'wsGwugwwwyw{w}wx'xGxgxxxxxy'yGygyyyyyz'zGzgzzzzz{'{G{g{{{{{|'|G|g|LJ|ɧ|||}'}G}g}ׇ}٧}}}~'~G~g~~~~~'Gg(Hh Ȁ (Hhȁ!(#H%h')+Ȃ-/1(3H5h79;ȃ=?A(CHEhGIKȄMOQ(SHUhWY[ȅ]_a(cHehgikȆmoq(sHuhwy{ȇ}(HhȈ舏(Hhȉ艟(HhȊ芯(Hhȋ苿(HhLjɨȌ(Hh׈٨ȍ(Hh爎騎Ȏ(Hhȏ)Ii ɐ  )Iiɑ !)#I%i')+ɒ-/ 1)3I5i79;ɓ=? A)CIEiGIKɔMO Q)SIUiWY[ɕ]_ a)cIeigikɖmo q)sIuiwy{ɗ} )Iiɘ阏 )Iiə陟 )Iiɚ隯 )Iiɛ雿 )IiljW2SFPB4_EN `'DISK104 `''`'SYSTEM32 `''`'FLPYDISKSY_`''`'*CLASSPNPSY_`''`'KCLASS2 SY_`''`'@DISK SY_`''`'O<CDROM SY_`''`'n*<SFLOPPY SY_`''`'LFASTFAT SY_`''`'(NTFS SY_`''`'.wCDFS SY_`''`'8oSPCMDCONSYS`''`'yKBDUS DLL`''`'. `''`'.. `''`'NTDLL DLL`''`'WSMSS EXE`''`'S MSCF*,IK;' flpydisk.sysOc*K["Sp$ou]]++A~I]LKS(5JO_WG3盏 jJ_>n5k|.02CV3`kB,\ch"Mɵ.K;Yl}H[{;FNGkMN[$Ba E'Zs@kV>DRrD$@k xK%"(8b @1³! WrJq|emOKV;ͭh{a_ޮnOeEe{nSc(}͍^9!o7}vw{6) H[#-(E1[)BF'o=?{4;;3L&vS؋5}%!;]Cwl[27Qr;e9%la.]߯"jop eVVE=c_!o3V+ǚh/w]H[K>ZyPޫ4EU;X: ( OP<9𦡱7 n>ցoEGT3&Gpc^~i0~a0NY0Q0u$ܾ9d&8$#ʡQs/a!tyqMPOC vjP (;j5`W#E%,9mƎ֙rcٖM+63" Z# VҔO`sp0Poťr28L3nEewݘ5DZ$my j=Z$P,c(:|xm]Uߟ ڍm2 c bб  I('׿ '{h IBf.Έ9`4Kg,pNh /qa`|/tL6-Jj *y`yZ<\ moO'ӂ* 9M+ aAn8ZCrw:h*Z-0PQ.b1[Č1%J/EK P1Ya"llYc&iEG"rut Lш#^MFP=u`M'Ѱ5NN~"ji/ LÊbC? f7 $MHİHYK@Ȟ&"@9iT3ͮYEa+A#צ7, dĚx2*}|@)Р 'AL[?xp:S5"xb #6: ̗X%dB?nGOo ߁9A_#K lsAard F|]v$.倇Ro \ͤ戼]&36MV|P]n]rǡ/u/l`VX:sOf贁D‘4>Mi*Lmߩ|.$]g|7X3XРjso< KSyQeI~)0*%.+dZȦ6A\AK̚:ׄp -v?-*tT TjD k-5a%b^dg $D'.'(&N+@[MAG Ɯ`a6,<qw Ȝ==KB;89q9!1 PF~ɉ '1r0|}nyplym|A|TWyΔq >n2-~T-e~U~XAWRt/)Jdp{uialY HvM:)S|jY/T_$Fi)ON퐐zVhS 7(uNoKhYeDޯJfHf!q!~׳ xOoeӲ@$@z^9}kΙr. Oqo[X\۠61Ǝ:kz\$՗iL/t.!`(vⴓU3\qX,ז#<#6'K{GGBef| ;=XDEh[@ńDp9rBz"XJh찋qMgF6>͈x3D4 sS{˂.]98k^0p<: _䓩|(Q5ZXɑTfM9y6"l47"!s;Jto#71S[C$7 W8.ܐа}c7YlA:[+գն8CpîHD7_#$yHl> zFyw&s<_ 3 x&F(W]4gBSo'|+=&eCNƤ tQVkw0 $0%`:#J;<(yEl+_^=tC7;dvU ~jrTY*^$Xz# ѥp"*5QJ9=?OʒA-K[ s\+>=["uz^p Tϐ ŧh S#] ?[J1]C}^P$V,6XL*Z-YaxZ0R6sn'k%UlĹa6A51#rfK#:71bkTX}]8dSTuea?73DuAmu7!5_̞AU^~8X2>gMRKWc%.p~wl,%(jifNh֐Gۚhҟ7-!NZ"wobݗ=:f:)E҂vDDJTQ0Ɯs/$ ζFmYecXFbA1s]GH+T}&4x!Y"U,'ztc),RE wlvuXNB/݈۹)p&wX'NS*q]5`Pfi+"=rC 9Lirj8DDXjЕP'[$x%I4Nn#N,y OqTQ'{v{lk}@z1~=:lyt d5KћG]"N3Q* iǽzȅ)}qF—#X ߚvIyf**/eRR 䅐jC r$zTʩixS=?.V:EJBXKӿ6#)śѳm iXt8^zQkw8qAk\['~ʩ?K֩Vhi0Rzr|oZ[E!#d0?=B FP륾_"Gi<܃1P~EY6|sr{91x9ETOz~rx* ANɟ2 )Ķ c>IE?K  hokS5iCfԃ Q{.gP!E9oB0~TU${˜j9lW.^kzêױNEpA'ߛIK0+3ېݬ#I.@2 Ncm:;cX 1,[/ v`6y/bki $!@ŒY8v% U,\h4 /K#GT="f gש;X8OLm ]ڼw篳!#Oڒ/㊁:O~$l+Ev;Jz|%M|;M9rwNDܱKsfIj_8t i7XKfD9nP^+ "p~OvJQ3mt$E%9sJ'PupYyK^ fո)*!{yO'``;2&Ƹq L}JQ{!s-ƙ~q{}q|pqnpQWhDDP<+Qk_C_91C5XS:EЊqt]bYޭ xϲIKeBZz@IO~}NSs*}^2 5K۳`QGZ+1fde W$|m %BEHLى0E!@ ͖Tu^".gɥɗ=l=hmfDF#e:vcG̋9(`z$;s S˗mK’Ak<*?OE\V -g)#Ƕ>/\TrM+ܱtg޻ wdyAwmǕ,,Al/-"NQ(~6 l?B4;2P jKzd l Ȑqyed Iꨜ$J)*8c*"*R׳ )C`ǽjiZVSL jC (0fI[(BbT*Z,c^S6[:Q{Z |%ij"DknSȂ(cue+7<7O̿M iX͘n벨9WU=H[v0 /1TG?-;p`6D:w4A)ClsqDXU+FQ)IZs +)h #`е;E~~vd:E t9wҞ>Q㓦OH?PA2;0vjdv#5XZkW,ׄ78dHt؋L'9mK8HUK 3mƏ yV@Xz/i*ڴ{%@cG"$uJc m9m2 i7CRCòp4^ײ R(_uAi|zphe%0BV]<ŨSdt0y<<r8.Ab,v]{7k@$] $tytWyg/S%!|ʡ<@@ڸ){ vvtisjN^GEK0O5.x `!N XE_z4c.9лٲn &Si BU# [ غXB*~j}m8J¬lki6^Ϲc%ȧFRk@Ŋ1[}_Tp:CF 3E)n݁|8w_3&Xꔽ4e$\+u9 '>,7^n}'axċleCl~1=);=nJ֜fPK {7g K@VnJFvYU$Rgtղ.x7}z=t6Txܲ f,Kz2J#ZHrcCfF]0XhC&{RRjկЈYwN`.\>ω _%by˷ ];L*2A%=pJKN u̷|.ph\}&lC+$#%\j6ڎK +r1dcTi-/4RKp#Pt?u;\B?g7:c`5ˏYc2\ hCSYm }:>pt?Mxmm[$MM{F mC2}ȃDd [./AShMZ`ڎH®ࣧ6Kqm )T"xa퍭!vҷ]!HU3STa ?й:S7}6,((E650u2H@gS:}M_""^ڋ6v2ajbcvGCf;!" *&s^>gQgR1LGUHSI޽PdGy€gbGTz?цL-veR/-yښϫw\'"娓Y,&6\)R›]pp˙ Q}"h# ACRJеs6zhQa)A"8?fckz0j=b5{UUDd:AӀSS`q?o+0ڝoBP Fb)$*%C}j; F=/fyt]3CɰQE4ܒ %TL^Ps}ЦP)\]CmQQOd51 \ZҪ֭| dJT^h/a-?g ?2llrs:YYLZr;› yBvVVǧ"hEXJ-,rs3.4mf0U\[tE)5hPCn4\ٷI*9. = @'?QZJƆ?18.. C\D3nC)_ĝ xUD4,uAb)G٢?Rv@EYN@vƈEYu꫃0`Szxɛwf:r~Էvb BToxsjI=dc[LݚN2ȃ08t;M|r] XPZ 7hYbɋ:8kp |=R@|le'aaa=\4w^@OqܤN>Z<+Lw?@J$/t=X>ZMo\#e*Qy3'"ip?-ɋ胨!;lxtz}g&ѻKC&7{VŜ P$ܺ0/GYpzm2ɤ-Rw/q`דr?[NݸD>xb$=f\$Bx4QBJ4ȵuk> ZT'sig- sjWwwd$(2-J.qSZ1?pF\n)ppܵWQ99=&u+ˌ YZeDu%HPnHgXZ'^w2?msvxAӪi<~2iwL 7:ZՀ-SeՆU„Xģ,-%!'qg~Yg Wkb+U"jz^ʽ&^ Ԫ_~uU`I`XTaXaa0Vk+,,%lX; >a<cŴbYb^bcbfbibkbn1X[@zE.XD䞪NNpMB6vm (YDߴC\h\w.{tҹc.\W+Uȹ0U\רujet})Y`{{aLS=*ĠāL:=p :2>㉝ILul2XeX݌w%>cxl>V#s劥+ (mRS _%rb94 SSS02227Z2?ٓedYv9CiF[=+zr^{zcf<6]Z=]..~]̨/e2X:X5 vᅝ a%Ĵr}bQ,Q`'UML,XܤIII11111|L)$c"[*.^^5dW:_G+* Ƶ2:_:0dDsc S))NeJ#d"UI+*codd92: _zx't[nVMSCFK,IpF' classpnp.sysa$I[7"S`$NHBnUYVk9umoc0{6_% lCsG ь;kOcO<9I&bklxo4ma26=غoF&u:nАu[bb)! g}AhDQ""/Bbvȍ9u4I}|u 5c^YV-G6bbZ%-6E.T/X\*݊BZUk?gj̬,FM㵿+A`0<.6 p"ʯ /ސy:ꨚ<$BV.K\*L7+yd[EMbN'ߘSo@,ZAbev9<؎XS}3Kv*L$;}kgie(};^IEN߮LVndvM/O0$nIם\ҊiؽiGxwuUS*͚%L[8p%,7"qMڔpAՑUA󩊈2JcАrf`޽[FowTX7^D5W ^rWo1*']rP@`20! .6`)|E6O"װ-Kx xK)70β*) ?gG9J,@0ӱXhKmFXuV vDYP][CEڶ8P_(&AUYRcB|Ui¥`` .nyRfjlMhR7FC9Z0jȹUhD1W n u KeQBo׀摤]5'n)eI{vfjm>+}dV'GCheG̘?L\/[7>u@Kwv:,W"䒷dE 1J-ذӄjdD~owӳwD:{$$mZrR-"`+Lj]\eR+r)f#0Pvm0;"3G;EZwׅ}g۪:E}[U/FU0 / MzRec:KyxvY+whX"J ج+X,?g,6"b %/(6De:;JܦPO+LU9r*&"֯TB*X#hGr@6o yZ$REC*O6L@Svx)rC`6j:Z{j_ub EgXQF̮+V ]4pzFT(8mh{]5&]2~v}9^^y%<##-s'Tdp_IKFкs1$sg[Xϵ d?NT84{>4cяY&uQP)TG)]Nwtk.f|cVd&'APEGT/)x_SR6Ycfsx 풚)If?7IV.~#kI1AP TJ| Q+Dov 2 41,U5ufRH[rൕm!7G QV<7EIf{uo#=IqN.M[ 44+׈.F= |pKmK@a)`*RؕIdh΅x^ 8_ :]ƷB~͔e0) k-8KYPYE6/ dykFlL)U&fH{* L0|-8]ʩn&ڇ;0P`æ'uޘVK LͺwL"g?MTeve^8htIipp=@ 6r*s5}䞈d+y2`r#$aFe-JTT}NZҬ{h_ Ap>3}4K2\cLz|,0Rn}$>> ur"W}~YeIDUF፸LkaXѺ1Fu!oX9ܥ>P1`4 ?n6laMYi͹nx0{/"U]`̬DhAz+$\ghVd^RɱdXd5LȂv_JDAi#!1)Tkl[OQ1̔?|Ejs&# daC"J :g=+6OI5 lg˔g0hfٓ`As%-{N!Z.Ϫ^Xx|S _aqgڑI3#yoͅD᮶c z]9,lv}F:@p\@d kTHq9z:|2t&Rm_T~Alɕ |` 1#LF<5(EK *xuUyogJr&fuٝ2,2댈X"cDA4/<dV6[}50:Wkr21nԔNT\f䟭RZdR+uH%W! G'xCZT*vw$v)•1-ʈXdFE̟$dzjX9(`[ϡYpAͷ"g |d *?Tܮ^XʤL儂$]zy[IZd!7j> 8 &oN.%WN6?m%ˡdnb8&`8?kiM20bEaܥo(:I5xU1`rZDۦg:d>O;!3fRz@4q6iͭ1 )v)0)A(NvJH[NcO)Zx/)lb;!_U/Qv +ǧ;5G0pUYe2qFXݤZV5mk| n昣beaE@z^טWˋ=D[¶RWٵط1|8>HWs&7ص22JOwIMлS`o#.tڙf0.Ƶ3LT ԅӤSZCX`nEx{r%r4a&-=&=%dCV(bh23]6 ^<>BJ "0G PGJ?1݈LY|dRE*&fpw1FUฬtM4%JzlL0'U~G/ aKݎ, ŪѶsl᪒]:~je3Y>{$j*nS/X)Qذq^0ZٍE:Ff~4픏 STv~J>vMwNFIqW0Fʸcn<8 7$RS/ >U,ʅQ|oqKtBX3ϒixT1ϙEPP5zCCHR^ш*EjJEhVnH8<ߛ2da]V؇}BV3S&MM91|Pe5 UjU'O)[2 I' WxۇJ2 5AҝTdM3 ](\1q\TBb*]kҝIMli3Eibj3՝)ʤpBm"XR'dQqg/E֛0?x߳L3a&f  ?Tp,yGxGu1Љ 'bECyVu/_|Nb||`فV|._psS %P1y.2ۛ4('a7.O2:1O !|=,1FݪEQcDI#X~#HN2^|.9e_ ם6f U/ fUBCK ٮܕ3.@4ǝ`Ԃ߮?K]'E\UہZIڪLVlF@*,lJ'I{ftra梇q 4 52͓dr9%L ?]s;H9MV:?1 Tی#@i)1!xHl{]A!p늇v√E6pAmBܠ#L1sSn{q޴ңP͇\;82-ZUI.N >%7"ui%t,ۣʌEl9H2kɈ #?gn`tjb%D6$nh%z6]u-5{tEvLA&w5I1 ;0w7W('h߁t` h3r'˷Zz܁l ERo@/ğۋӄu7Dհ}y:Fv6!7> -q؀HаJBX -WF3ӂV[L4x t) y+ji!ȂѪ=~ f="Y &`lh?> #oD:NWRNO0 Ei}6ښՎ=,HnGZ?E%H0XD{[iWut(Fq3nZueӉ5j*w>t `~U&[rGXnL|.-k=W]U:#Oh)׫z:e{h}_i;b$"mdf$l^:kVc" ҆iaA tj~&HC#@}zAz#B2{r^s9wi# zƸ>_ .mnZR$'mv{BĒ,SI3ſ`v㿩ӫ9S7D`i\9k_\ TgȊƉ4OB gn4M#j>h3Aˑsk8rŃKP|"{[jӆ4V4]lT&NhqamʹJ8p~zW$g\Ԟjv&Yx0"=(v!;Ԩ½?Pkg'*J^<A ^(~_xok̀BY%G-7@"$+h sao9CĄAͩ.a0L$ !vMM꫒6%IJ< +P/YY)1U?$!ˢGah5iQ5B9g\;gV81$j= gUl r=#Z'm j50Q[BJaK+/a8'7k^/hC\)6qf۳ӟ_bD&ˈ-f&Δ2cO#B6 _hGf~8 SH5HeL;m $8|;vui3TAō 2TPq^u:eC؟{=Bf~sLۖ#9ehcu4DZn^ZPS< ][g.FJ,Υ1 +Se9 !4̥=̭ta8E8:lև(>@B|h/!'Z "m" Z8XnmKi+]QT]H'w-B{ Ȁe"jKU<6*} 9Um/Q%U8qmK&D>òj9Y .i:< ,i[ӘD1YRpaH9+',t1H +y&DFPSyH7' ?7x(OŲ>sqR[|6jXb&{:)ZEVtu&ԷT`E0+|cEB[|)jHP~REv:,(X 92qeɻ]G/54-E22lG"'B~mI1'{ |iX7& Gk|!xl)J]@Q\puw?â=ɁaEp)o"ȻQe'NE))҃P9)"GVrb;$XXp$GHakU? *^I%UxTIqKP*Aj7a:~/%diDaoSwG3(H aW,>#v*@")ⷁoG5~tr$@8p:o^Ŏs{=/0eH,|񷎌^B|ߌ9iD"A( r?˦7;oR/I'&FӄMݼV~1IXDr}fDs=I AvNQX9xO6?q؃+n ֭xK4Sj$J#u I1#%_,%j 0泝5o#3VsSF'b/\ʕ(u,NŕT:2wrP' *zy n|Mz)uGڼ({w'krOTr<Ӈ &05G)_c{ɬ5B7iN<0@o58JD=jl.zMf&d /_Z$Hux%[3]SJa7cUryI sb$9ɻsh)!e7C5.]ƫ.Ђ2Ej0R^qb,(z pzuSjZVz|t:c#qK5>Xn;%iP-sۡ4ѻR:gtmG6:I$!~[3@j ݭ:u_u.K}Ƌm(Jcp*P/*ߡ,NJ]/A[Rh*PXۅ%jETS(Bj6*>5dG#9k%De:)!SH˥2 <$h#=A4MA+PA>g-L SKr,{h%.z ч_o5.!\c-= j%h.ObBtFUh=2p3}̱"4x38%[X(`[2 \)&A*ZO5n(oa1x,; Ylk]yu컎z?40cI5@*<Cek Olag󘟄gtc|}0{r:2(Ά2%5 @Ф's8p;V6p*InHKTIhߔd7Ћe56Q꿚;+K#+:BQ/%(Mx(`$-ur`9Lv\rZ0$$9bYtAHVU(Iɝ8': ԟf^;ɢvB <*nfgь8AKhdb e;|At@d4N'~w%8v Eӈsxo4ϟ%Z:fx䂫b聶x iga?H M8Ĕgp'lB/I"A=7֥?gޓwgZy ~Z6MxBo3k5 >2xC=/EDaa%ٴŢ`FǝV8+<:W%'eK-Sp` z[Z8t􄭂UZޠa;Zhb?](șȰsI򵾮0e_˄p鈪m!d0Ϩ!}>F+\{PL0ObileA#v=_# ȋXrl2rYO ^ܜ)xxj?_5lE&^IY(wd *aau>z]kY65MA7Bm1V&Ag-S4 1󀃔q@><1%e +o&JrԩIɗ V;?85nA$D@U^坩<=^?D8j؟ SѮ̓*u*Иme#!2c&㬙81VWvagN{eOW`t2c"27Р9!о [f: 5Om ʳsFrb4Fض;~]Q'4Ě% Hy`w>_7 o_oAF;{& f̈́VijGQ( J!wisUPB>zɟwc[M/iNA?٭mQkifƼW4/4@}*tj9L#=_X4o*C 'A8~}%h89F:r X#8ޒe}i<䫝csyFt $[j *?#WA̡'4QoI0B:JO_ 88٤`>(Dz@FEQ5J-,D͛EohwEOǽ \ ><2|.\+Z~ޏא5y·UQ(@V$07\wݚȔ6e N}tOU;Lb]ۍWfzN"˵" b1q0\PN~pDyN?†:P;nWϒW\=>%JFǍsk{B} !ȶf+ n AG=x/]1z\3Y;_5Zt©ڊmƴe%bsxzKG]R  XAEρ2=?[} ğG6-HY-_@ vŠgU՗ӧ`SLLQcQ+%7ߑwF};olsD+=@WGj~5`MWO^iRyYP7!#퓶GdKs)jvVڟs8px"y~z9ۈ yt|6tdp>j{ JNն^ǁ^t~ CӣQxwKrttk0s.$Hu~_ %gKim>)N&lRBg ;LaUHFO3-yv=뽑7{Ap8sb6X3/a)BccNX^X=U4P;ަpX*Ͽ+V~tȻ S I>0U4(a Ðjgg[h%{ jۆD8؈cVCJqWJxd1d21ݶ^H$\bvƱL wJfVZg"; |(1P/JWw6xeP)!K +N6B:|hrXMAI 6dglr6DjRCΈ Zz2 =NP>WP$+o"I]_7k–&5L{-dmFP"c#'-]w>f! @{icYЌ: |^3@ ǔ>e?8`.yNzk@rkxӡN{[[DtZz]:OSj\lTg ]`ScR?zZV} ގ Q T-u;uYm=`m'`+G|jPǓ G2zBR243eFkf2mQ7 ,C1FB@(ew3O g 6sgUӃD r +t]ҳaYBD}QVuyE4>s{k`Y!klU r[\WTœaUnoAq|!`kVbہm<qp|jݘbs  sbDp(B^p &S*Gd7GZT@Ipu)$1b}O8-l+!x| $ǰ.6`?4L:0;> v͑Dh| V4U@t79lEg:Ǧ+NM{ӭ-67mƢiJZlZBgXoXE:^<": EkDˤWϖ]X]fH |E7\VGG Ujg'e_[Q!- /Rm2_;e?Fs'8ob=jNcmyWG5qӶ=o/-IUܿX5/tJ?iÓN5yh jߵ9UB% ntvikX˪#tHX@U*wɎxi:WqsHzt/Oo lXvs1#83exȷNKPcZjmbiuwPm٭lJ-;)eu&4{ei"v4d]JH],dFPe*\h% ˾,[qPm3KH!͉X&betv+>vB#ىL.*֑=Tˍ&2t3F-8&vI۫i?S,QY:|2%8''w˻)aE<-Dm`s6t rKܙ읞: fߎLx&8rtc3)< EgUˆYBnȎtK I/Rgq*Jrfε`Vdm> .9i5J\MDPd=2d.sZ1** ])MgUmM/p<5e>wllCg(;Y=ejMvYodˊ2J~ۛ=SwpNT0B]P+0ɺ7?’M^S x+4eML)S 3_G*xjI館c6GM!ٱOg)QTGQg"w%9EL}Z?"wC]RFk"_ piؼ,Zպ@Q]ű+Cj`aZQYdOo X+{eZ3*ipɠ/HOK0x(6ctk]sˀ8 D( b5 crm QT*HxVYu6Urdځ['sLdS!"SFSզFJaG"u2ǀMò]}ݣ=OC_~@hVdX;LDu>}u2TEZ;D$4/>A+?wN ]-buF*be\wr>ShGӥE,HniCl 4ʔֳװο`DN1:V9Ҿ\!̊{~;R`, /(=ƝCf : d$DyHNw{9]U{U  fͰݘ_Xl>ZMd;^@vb=2M5Q%1RRS}Vo[w+aoHkTs\~Yjפ.Lw]x{/^+DK:_*X ,,lQ!ɞd0فTU,icZ.벻. ePe\e_eb*lLVf_vewd0C[*?ƹr.ވm o}uxb{_/ҁqD5E0vd;;br£5}}? C2V Imd8OɊDI֠6V#[.¡ɥTۚ:B}FEQ\S\Vm}sH_seY o5+ѥ֒^q/J_ .z`};iebwCz(أjXZQؒ%ȥre[jJ%R͸>/Dݢm)o[oV%K| ߯QjZFqݍ 0ONw'CjYD Z|}xz_[lqk߶SNq x@ Xٔ~i'PIl߉:{IĬ5p}Ѹj&@Tս[SH0~MoZ 1s @uɁ&winӝkY1[|⁧0ec1prr~:LW)rj6&|58Rmyw|sC @ܨiPc g@9Ac0OىC uqh":q!!hAsG>Otb6M8hT4Q7u\s ]cZa}lQ`9cl`&C{n/λ]ۇ {;^09_v;-Mk< w(N\j%9(@͎i^]ܿ!C`q~ B&`2t5?XpYgx@xPx=a:hpwyQ Nt5R?En)| |=˧пa@mWeŮp9Jo[1dA,+=k$!s'~ b*}l(Ӥf&U$YqFC\y'4!8}xn`@3e=#tbjT{A@ .L!U7ihЄ%>v7CQ:eԂ`DhS0WUߩX_1#\z}< 1J(V߄W+|MӉFDU&+U]C _@lr9Ls8TR賤|!KC,fwL*>kkX[PP؋ w0sy#ј`JǂmUh[J,hO: R5 jm4((`9Ddi h&ylP ͏dh`CY6Nu \UV2h1@EʸD]ո4Wjj]V9aDE}_d%.۸•Ng7@&Wމ:8G1q S_ ADsPMۏa 9I@ >:!rOWl-՚y'AR>iDMvD ├ X@ׂ1o`&VB<{E[-C>dMHeC=P( I5UE+HM1(S^ڏA (\K l|P۲5[zڠ ̺%3"UUbS,+m ȃƇ2/81dowbğ!&rJDh(v2X$A:Y=AnU؂ژ4d.~E7;fl'ڕКj,cDCҟ{g}ϐyoqS`5'eUtۃ YnϫSB&-P}zG1f`6Wsס'{q3@+ ӞXjM2-m4TNT*$!*p[䉸)ɨóS4qY϶m{K:@%c+Xդ{hC']h[}=?+nPҜ?xnA%C_Oۄހ˰tA-7ޙ* $"ngv/MĄ1eM܆XTBK{"ZPi֜\\cjRhH{$y }M%M1pHg>{Ho a6jB}rt/{Nǔ9t7p[eGUizWط6y`kG3i1/϶@ziW:^ ND{5xN0ǣiE\5 X2'n6C&D$/eTz.%I|: [c_Vv"k*^NoLoCP,gHD;ᶬn`O#IkԂbOI "Cp̠Ce#HE+T0 y 0qJTfZtM*$6aUah8R*5I %XDpʎ Y)˘(Bg5!GZgH\73 3R4#Y5!cz۞)vHV6x8 VBL@B- <DDeu˧pɰsv1jc'/a`xRVYWAdEpX*EPI*L$DJERr οʈyV:FTU='Ћ ?F%'|Z28 OBW1TLL/oպf< %o&a m2ǰӈ ,#hhh4F{eg|$sE^p5kz*rF8bCSx:*g=j82y߲.3MSLR_Sxh҇&8>*ND<*M[jT- Q xOƜ5fD' \T^^kw°߬& ِ?P_wl/ٷ1dD7e=,fldkjxbV(3~  ¥ը: A@;%'&K(8#BB;¬Crؕ7 @˶F%fȀk'IO7Wͪ^CZ>'?YZ꘢^2fZ{15*[ o7!Ad W61@|,Q_[j!6(I),\Un7o‹®Thm}n@BO}(|">EpfmC_ϠL9C*˗F>U[$?Q:7}?@dVE'|I(8m.RSÞ)z٢\<  ԦUCO2dH^ EJW)V}=rMr@}Ӭ {,\pp9m!6jLr[uh+E ^:j^`D3X'i=E~S{bpmyz;PܯnU}DsdHF77fUC_y! 3t2NhTL>ͯ%,k…#qF|t)!v ϋS \ɰuDsڳ'$$SmW ЀgѴN"f_2(^taU<5$&IUnǛ{qMZQF+OGx*Ykn6ׅ6#h:oD!%j)m%wͷ}W4`&}}ի4׋^`b%YWv|RYhHT',Qu>nCf>ۗnbxcx. (3o)~9؛˗j Gf-/"x6Pe?㝗gڰVHٕ"fΓ WW@7ך<`T9זI(HX Bz!/;X2zN OgL*Ōǜ4*06YӲXMWoQaw`9 QY `b>M&F`'#->C%2Ebi^ &8 igG &}l{n? C6ai]3%/Sjo?궈E^O]/ٶc1WT۾tU3m8M8SoM;B2#1_/-f G"'2U?)¤Dg"b>z_ n{פ&0v:efDG76Q26]=HnTBCF/xwR.A 2//,"&-.\}Ѿ(^Yv Ա-jK̅bk6@`#h HRW)9H7wX(Ï$ce$JA Gze!?%9}x8[-#'wr:#04C'0?<YVK̜/lS(fEs0]#d gWw [zJsD繝D!%%= ؐfTOVWTٓq3u&)JX)-b$Z孅 T:Ƣ@fNZV/=v﷉v,&z7&8f_GB:pM @ÓҌqV)5\!v &Wϧ0JO1GѶ:RC|f#s ;ȍURkÉTcg3R XUup:;gVh#`(e̩?ΣׯVdxԾ'(3D_$6*@֬vagO,*9´byVl i]IxfD ٍ>hJٷxҼn*/*=gAzyƫ V d*,ĩjdn^V'@bĎ3Ҵ J |XVlw$` EƾSCs烒W B]G[0x_A>ʫ+mj vw[Τ$- ^R2 7{~0(cz}*ZhM~es, {Sw˿LmAeTz("ĶecAg R2#+Qut`1Z^{ Лa]/dIi*ʌI EDq]Q J8?[j]I&]} 񡡖 R`ۙ"xiykڮ/gQ,^Pb˻h۾M_UL_NZsIcl2^I>!rȤPs;f,4=X#`G@ݫs_'T4vuqNwsEGww=].{Owy~I 6|b5Nq<% Kz`z9>o|ry˥q.]we.ds!EEˏ$/T^Ee~Ըݥ׻d^Cw0Roވx?W׆{g뫣z^O/uOϒÜ||/WyaWݜ!ލ}}/Qsrm>: _|^'KN#ZAu`ҩmͧXmʍv0]oMSCF<,E0kV'x{ disk.sysrυ\<0k["S`$檮RVBV]U5-KOUtիM+DrW2]WG~ރ oCo!cP=`|!lE!F! CD5#pv,i,'eI1;,,gVunO7Xr;Z-փd[n#d+Z2h#+o!V Yb &{"D#D DڼZ$@|0dwpPX?pHK~{! .wun\(wR&ru,}dTʼϛq=r;-X7Gp7xrhsc5Cj%Fl)O  _e(*>J49U9oX;C_wsi)¹/[%Ózl!+flфOſNG6{fqohW}|JJٲJI3b :mW/wWV&&Kw:3Hsxbw}՚ΟYG+\+z3ZZ (r̤̰ E8PxXWX94kP^M*G'tyŁ<&qJ#.4m&U "I-.[̻.d_EKE-N`n\/7L7'5k`:>KC{o >aH/ӥ۰4op~(PF1w'd\t qGIp# S]=j~[BL}J%uBdƷ0R3r |fDs߸ڷc4$ƶi5uw3C=lY^3p<3Af 5ݸSH&[ hъ}QK!ICf AvRͶ `<`x@¶_>/|{ DQ!/E:tƲCLW8/rxd-4Jѓ 3AB 0. D =",jrtzO|i3Ѝd)skńj[>zΜfs5Kp\aWt#$}I M3N46J3r̩OD| jK|4$ jB"1$Fy<)ZΦp~40kH$oZ);fZ`n(q edߌX>7,2ݦga^9̒,pEMhKL(! Lp&aЎٙ5X F9Aom8gYꟼVAk6IJ,vlYN,I3~3E/&-,&4٭ djLVs m1u=y:rpH;v2M %-nNwA fW$2? M{ws(tTgmĸ=$U. I ChSw,(mG$u`R?2bw(tߒ`40R30Rqs".a#š=X 6Y&2']/բhÜPp@$6}H/gB~mW$Q:Y+қ́%X5F|VhpllF2W6EZzg,Ld-RÍ3jG9F~l;,pj0n?[2\U/H0 d$0;85qr`~gza9z/.62 (F'gBb8>RఢW[JsQҐ:BҞ]aKy t$up:`W|2.{8i<@_䎋On6/u.Rگ&G6xHeQ a "-_u$)&qA]*_4r:QlHiWﬓΌ#+oãO eI!J42z nofb޺pERoq<<\o^XsvJqɱthLC[@IR@C 7C(j!j_4@ :ù 3? s]y9JE n_K@SP`^p`j F>Gu7W6b|+܅a"P$O 6o<A#K7nIt`7}\7va6Fsq% [Yn=ݰh/xl()]㒍pϟo}n̴+YDʴRM?p"z_&~TZvF #nYb>]-#xVR%8Ob!>*x $0/N~u?n(,l= Eq 5jJHy:erU 0Yjhf:h>TNxp߀Fx}rEl˒m)`lK?T<, g'J"թ]vql!tey7CJl%:aZ  \!Ǯl^XR3!H4S8IP^:)ƑCjԎoeJq`%ՠshCIۇaeZd#WjjBT`][3̂Bt&['}UCXIT1Ɣ[FI!idG;º&dκM)p])4LS<,^iJ)I>F8NH U+n<'ru7WB| )҈qjYa{ P!!UBܖM & kX kcK]m5  N Sm Cqf-SV.#ycƂRv8}9p(yad~ԂKD7n"6S? <`ś=\(5WL 蝇4M2P#]n0f% Zzc2CE ĩq`loey 1nihdf{$&$TIyCzdz3u!좫>2چ?QQNߠMtp,2-$bD IDx>5˛MUbm̤>{HŠ!:Š:(n)aqYPz';u(? 9I}'x|wWtH0p0 W07is1yBWCk=<ɩ 4g9{g^~0;F6Ii"6 f<,ϙd8yZ1sZrXd:m8aߓ.ɆkéF u!MWI"h3E`*ką?$G_{=D|ZRUl7XptT8{p*a2ןq#MD 5aNڽ|jZ|P"^+]l gk"VD˄x@tKEYHے3X Ĥt%~0ξ#0ñafP證eSY}GMxD4TB}O{Fۘ/A 3!{s ""L^Ih}F$'57LQy1^V*S". BҌhGBճP>IpqZȘad*Cn d%`JR :BF"5ë>'kbB#ᩜpBPb󣕜1s}Y\zz܊FɖBk,Zb_Sls=l!#KGX40?tjCT\:so!IFx N㿓JFDQ|㞾; $ s5aX̰Ѡө$L`u`M`z{AE $EH3^f=p0S=V(Aj~agh)Ιy B *eY JQB*OJJςeBd9C/gr,3_{J斚p`+(hb?c8YɕDSrzʻ-7wgKŹ7hy쁽}Ӫ?) + ͭSAW<gL2:2}?y߷z4+O l&s'j{L)8ۦ,"HY!xrybada{':u7`j͊eUkCd#̈́̇)}1`9{VU_dDVM\"rLFz楄_8вԺ|#8 02V;g~`S(H9Y)_@t 1ؔ ;C5$Im0[QO)k섢nB0+p]]Uy9oyBKb(NJoOfi\l z U8R#dPnD`L*rsAk$r21:K3呴 q)OÏ0VrE:(ޤMqun{KU ⓍnvODu0a,hɳ?!K)'&u` Q:elċa"R۞<Ճy,/ni\DbfMT<ʶaT񥝸{g"~ JSUVX/bDPzdpoE![x(OhGd - ?,Eeܫ=Qy)ߘ[YG0M1}1P~6H, (frnx1U9Zg[o U^M*<;|cU,iȥMPiJSeHunayd랓N5i(+Ҷm姲[W g[uѾ"*dW/k Ǵɼuk/tEvFε*&f_PqHZ6֒U~*-4;dm² q8Z>S![Gm==C\*q'^db#9#ɽ TUo@08!DfK_T2a_fH?Q`n}|EYWW6H]I6aGjBGú`zCsX׹;/cި\;0)(HEkP7SXT҈ Mz:*ko/֯tnfNbpK|v1Lؐ .Qc XLiVezGwIhr^!" QPn&֜X8ax˒= 6Jn'QTv`U2\>8*1!S ,\|ie`3x؈DܭWmNƏʬ_QʲD,p2&aSQw?DW (T=k7/2~,05 XiRZ}iup6DS6 ӛI(L ae طN?>"/4 Y( l[,1aB6CTpN0&+Lyڈ)8W|"8v@ Zь㷗T oỗnG[o k+5OuרI^ϛpu}6/[čOHupa-VzrjdgJ^VJܤ~y_Ly2z}ԭbna7 ]:?82rf5vCt՘SlR1m9]nݜ%NIݷMБz-mH>; >V]ʽ?iX=WH#(Y>q#q8ݴ5.l0~XyV7GWLI5xDfډWFd`5cp5a?""Ou\tI)[A)<wx"n@R]/^8)1aOHe{$QVcHO7"\c4vJ47Caj3PY'Xhmdt*kL2{ #P ;uqG~sDNl`dMxw APEiaS72枻<=VŰ$čH(ckhɩGJwfTx_B肩 .<\[ōlō8pu|LZsO`&u 2G<Ƨ*,fȏ[8ψubo+W.`ʇ[8 7nDBZOݮ. ;wWnznu{5KB~7Kuͽ89$H{yƗ6sk$7T]|Y,溑ui}ܒT vFtG+*&#Y;9˹׷ h,1TZt듕ɼY74ohd.j6w>ywfokIEK"%-܅.q/K0]z^h6@artJvu(G~{.P  ۓɠ#⥮HTw4#H`i\"u[{%z]M>8.*8Kȯ4]%K#r-~]ˋv^p&ϓr 9.nQ޳"~kiׇ&& 5r[1 H6]ߊA2+?xIi6O&N+￀Y'[;768!FfqI\P/i/;np&Ѿ "ȁ}M@怖%s%=znCh'Rv:# 5ݻ,w`zu@;zNKKvB<Ga"d/nn;C U \8޿"֦-4s $`n{'wxC^#Uގ-0*"Yi3tKiR" 7Sw2sx]Q@ak:0m! )_Ra\Ɉb,wQyݕu&t[E^ԕ3eٳ[|PM#?g[Yؔ1:qd5eJ"Qw>9Q^϶fQ= ;\ͮi˜iܛk7_Ȼ^ʴ<D;[&-ƼT-yԖ1 85U*Jr qx`m~Khf=t11q|C3(;, z3D Jbd%V[]fbղMSoJEU @0M,O%/wya$6x^> . q[Q1{c,e!!l!~!ň~x5%u+[ȴ÷|ڲUgdz`l+1?agoZ=(Z{ ͚žZS EUG_ N?_Y엝R.!j!D9DYY_YpYw#J"bF0ݒA?~G##ZdW Uպk-·dKlVgY߽g 7ZG۴ma OS>MuRU_*0 TS*Bc!UUKUM*%^UV}UMUVUw,U*î?0?yGGB[ rp2͂gYefnkVff5"XHX6 J@:ڔ i繯9SiTYYa[VzcWrU 89e=Cp  ؐqx0Ry> p>JDеդuNڄetVPcjzҰα8EcXU,V2B )ͲfYfY`}γ;Ku&f7۳|y22R66r7%M>u奒e ^ksZ[u"o-ƶ{gگm ʁ {jR Tb)TTNTU/%"LɩruQU_%TxN*W+\zJnEZu[  sE<D) ˯M/Kc ,_7WᲾl z|-I:០Y ۋNjt@]G/MMSCF*<,Fj['Ӆ cdrom.sysv;j[w"C`3_ڶ-rXXm۶ܺ۵VeA-,o?!IItt r-ЭSR@rzؐA(e8\Y`=HYkKb)ϒPÊ{zsW'!XZw3`֏GC@YlE܁)Cd،T[m'7Fܱ$w*w͒id`XE$r')4 쫭u`6Ɉ|UU{*?V 0qݷ˂wuunMx>jEe6N71c{%Bt8 :&'t8IĀZ/δW _b|#@z~ut^~nsN-,ws~|cʆEch a']}, &v;Y0+kyxx__|͔dr$=t1&7ɫB)|>}e`hfynz6ۿ3/fg&^,)[%nUn{|^` .hv.YSw)!^ҿo<.^<3(z[N9iT3&N+cDWVPFgӅXDl(^ŇoO64}#Z0(e@ -Iv[/C,g =Esd%|C򵚻mQ7F I~0Q13KD L>MHբpMexäRI#?8Y΢x\'vz\ѿ0rxGY6 /<ݒadN$xK!8wrM (">ūZF.2!l4RP;8=2uqX-fOvL8cߝE*ddU2hm"V<,{3a TE!rE^)^ƴ|T>c:76u9!X@,6a+.ٗܳ(@d=We֟ [cp/&ƽE197HQnBδ:MYH;3bDb9Xu2s K." emZo8@"x1=ɝsq3W@ T'shk(tHUx2-Qe[Rԃk-E1yv(DJUP?DifR嶞bC8% DL+hz,YEef [Qi8sd:! 5, )6뉯QmA贼Vw@u#ɝFw%g6Gw)6(&-": r1꺼`K"g?%\jl"%UkiBcѿYި8 1dWs ֤h>α(CWŜc3MLc TXsS1 `0$9ʥ蜳g /b/ic0͆jdԘP)<`e\lPua=5UBˎDž8MR}CP"i7 GCM%DC-Tm0<iv`h*I{*ٳhgTxsBg#fk5Xl3=tIn[bXιf*o4-,e-nr fU aH g)CHkK/nF3ҫdiY W&؛O-*WdeFKg!; 0&P&ق*=Ę7&ݘe*gRG'&E^k$ǝw!HHY,5<<ކ73̠u9[m;v[瑠(BCǹ4;`vUO fBXytna=V?XC=|4]W )h` icsƞ e޶M "<Nj|9D˷=UAuR#Y:p5H4ѓiߝ2"Gդ(k{8: %Q ׸Yظ2zi~Œ;i=1$NFwT=^]yz">gA)PPٝ5ۦSH1b>,䌫Í%39MV>P991Xr{8찬<'%b;63E03U. E), AXbu!uS_3u/` ZDf'PGbZ'^Uw)8kXJv+v$m R0R;#ߝOQ"B" aLH"6,Jl P-:E2uqu &΋Gf̹,V*u/rܱ)% H+ Lam,7(l .ht}~(Hɍ(F*HY[EidZGʫ\9!ưMN>9AqC,lG(_=¾&I1N+bN3ɸ \slMc~Fp^71o=0JҲռ3r3B492YLOZ2n--[LRz "tq4M!/nVhFV18vwS">ƕ6=rsj]~NWntY6&!Ezr |D^cyFq-EtólNlgwv_ItH!#3hn\5h]};=Ր4ϩ֝|!$DP>u.;Noߣhuy`~Ebu٨rN|â.d(ʗҺ.;n,>բY'ea{ 1mmtvKoE%Gg.Ts&wdTjvnY)o۸CU 6o:aPްo mm1cƔ7tOA x 'yI7v0 W͌獘A% y5mŹBm^TP> w.j邧>#ӚH/S-%)YTvG^3Pۊd' Xe#Ro"PF,b,\LUk* &kn4j"Z5%R!}J1Kp,$KF׫d7 m ~IJEe?'Ա AGtoƺQ^kΠ's?ָgnׁ^n݌"1{5O3.dŝI J7Y~ 7)͑" eP`/>r3&ԃx.Fog[ H%EL41r]!4h|P:^C{BK&Hva_:4" M9s+N5:NO3P\x51[= Bn6!AsK7wNl-x/@Y{WR.mY',{z9icYUrظ-C,c}Q.V t.l%+a)>/TcBa M{TE銾۹PPahg 1Ca' B>Lױ d_ߡZgXMP\U#>%.9=0V9F mn >ȠTLd J!20.#BY7XP:ލ4$aNKQW@%{]b%5ёx²hJE־5<Z&a E~̤TOϐ.z\6't m,H`pjn[\z@=*7ig-LU$P6t"!F 1!jyu[. Y OfkZ0>GBĬ31gD8.:g!AjxDfdQ|z"<%;\f2IaI]]ԉ5P\5;MOT~&9Y K3:_r aZ$%j rUQ ^2)qЛb\,•ʠRp=b}'%G*i5tp?gΖeZå٠amҚYݩ%8IfRJWK( I)=b(s aJvUtC*.sJ7f K\؂hl`r*쉟>Z-=п5 1} 21Ag1@\Z5,X-_u4LJEj`&҃dP3Hi]?uRC1>M­3`K#Pjh vx^PVeAw".QC"}.S]SBðG(di]]iECEqc|d!$jI! u[>`/\SHCOɪ3yRG͛i7gٴ y:kͽny[ooo[?>Jd ]߸㡩CHґ $R%N~զ@0.Q%iI6roS%4w1 ?gšA3|hfFu}P7?h[܉Sj42ejcrYJPmL)N1XZ dRV !ve*<Tfjퟘ{4a}|c` (wL\-'Q`rĸr6SՑưwg,([^F,5g{%ΧX}j$e()tzs0IaOI$=e#):e'Mb%(2x{%&|o˙Dh<BCoEԿM88ogdX҉0跳 T${3HvQ"l]/J@iZ]y=5f&T bl |YfvuxQBDيWDW-"p'G5`Bn̩C6,Ä~.o:x0=e7lqCËY YYdt>VU$UOX!Z,o&N%Lۑ,/_]iy_Ɗs}.UKCY, buje %m%[ :Zޜ)b #V}ohD[1 w/3$TII^k=_@0].HH0u%W` 3 8Vs:+d1^A$2+}%$Q94*[01CH+bHT|Hݪ$eRN{+'ßJY ZXإZ1"x0%:zR箰 67/ôV~&ʇb jmG,hHc1U)),c]c#DWoMiRnOt<`DZP0X@ժMgr &Uu*LZyK^pTp1GL[*ژO}9lgO8w*EuRz)B\wB}pή9WzRҖGM;*< ѶxV$xRLqc*]dvYJPq1YhCcBt7k㥁@[/cJ2Yb8v#Adtٖ[s緀u;ɸKXi?1($_dw-G7C)kP!SOP+GM'(ѣy_A!k\. (TOX|R,>dmDa $PgDěce12J2`]\[Z!>0c՛n+ B>H 7Q=(=؈t%@/Kėaxۘ|ph.B ׉iJzQ=@[x ^޷ono튖o#n_;х*ontHOlؒ>7վVWP$,mZWoKXzr#ŞM}"Rng`k\W% Y KR=@%ۻmKc.r;x+]/g׏KVՖ~Ǟ8:f~RT>2nA1׹!,зJ,CLN<LgCFbG%R&hAND!gi0֔5ʨ|p|y#a-ǀh  k4ɥKvq) qG">,tI6`;EU28'ѫ 2ً.(%)N[ -rk_#aG#o#3䶄;KKUv8G !k:EMNvPA3X3QeZkk{&H\rT| Kbd̾@)#?L)Q8׉#\w UKoܗg9˸z c%~TGVJGz?x.*L<*DkEJ*fp)jVIZOo,# e9VP({E>HL,!v 5w?ņi'^O؝0ѢBoqZH/fޣ6ϙT!/{'Ǯ+2k~>JYw/_XR6ǻ!]$O:esgkҿTfm\oK搋b13C%,a%ɵQQM!8 R1yb: a#Rm%Spe8}\ي<2׃9C9bJ~ ݜWxa:UVdZ^'Ir K2Ԙ]n% \A ՘f<9c)@XY)kz!(=Qeps d _M;uxP_.ANISHciO{ߥ>I} )zry_-l Ax#^%jY 0k!riӂKZLtqp*M}7QBDs%|":0KaG"]422##|e.N$-K]K[zc:ܝ=?^EY6:S|c %eL_l%RVa;f.sEMkhpB}wĨ[/ ^?%'wP=ح=}~t}S+ꏺ>L%4I"I('m:&K!Ѝ̳zxRfd9-W ޺o7ݍHyk3 Cm#'L1+,R'2SC'zpu!AnfKɭruN;Rϲ1՝Pj`@Y,p}xo8@.KG0i6 /,|%;D)Rg0r[H|-?\*BLNmmcJ檵ΐ3Iֳ+- ǩ| ;,uYZ`-g6i.LR^ʕDO]E"?n2S;͔lJXW u#ε'H .Q5239hԷ_p^3l N;T1,ahd=Ծ}oʸɤyKD\h'"x?ܥk)U4ϛʨ-Y=p^; ,bT0}\@ZK L菅f28z-U݋:cDr%~}vh3N,j +|>7mC*oDl:tdgu+L-Z7TvJNLoȦ#>B!F/To4.m"S=KtXϱ;H"i-|7tȑ b k2ҋBP铟52/2oyDdan7Hb~@^J4};1`@”@Pb]SLXAx8H:fOʚ?HCc͙1a 0@*,3SYt)]bR kI s*S3^Rm(@(n$VvCi 5m*geψu_]ۀ؄to9+SMoЇ ,˟yt;RlXW+g_hAM&N#Hiy1B 3ZIbOrF- Daq1_ ľ}Q1ն6fFGHfEU[{+/~, .S3~7lfF1|Oi}ZLV+%5WR_lK<,8݅r½A/W,,=Bd. mL0v7f(1.b=c-f ?]-m /7iWmfWjڡ6wpbz[ {Lj /I_`X`w0o"p" . ef*ezeq:CAL0Z7Zv9a555Zmwk_X,맙^d`]A#Hp>LXw-؋o_ Ǩcyc pC|]20Y,ȪYeYFyvUb 6Y,s 3+|SU&F?o`, g#0X/ňch=ֱVdgdldr22<=Y[L.Y,/K&iғzOX2V{Mۓ`7Nd2{KL'u͑pg|6>;!֣UM{CMjXװk55px kmFx%5O,"- >$I#}8-j #3!Odɕ++Sҗ^=N<-7fdzdz)g s;8,%7\,0G2MSCFL,HP(>'6 sfloppy.sys^vP(["Sp$wUe,b/>K]H]tL/O?,25y4Sי_Ώo|xX_4Y8.}ڟ `L/o .Ap2B@̺X+$sncLC~|K{%:%Kߣ2>o)#dCVX7LF Vs W+}(Tpv&?,Gvwy ';:^ڌEːA0C(2^f 5[l>RHb҂[mlZmґi}oA_eiIu0]c-lh)'%֠7Nd,r\,p bqzXJq#xwKm߸;&۱L$y?.!N`${ Ix1a9VP,ʼn3=JF)@l{=Dq%a@cd9r4%Vq6`>Tx썉c!΢û$^LE8v6@h<9\Cǀp`(>h%s{VM,YuI.yQ/KJ0Bsxx9`iBǟDb]ן DVӣ/F+%'];8ޓ4tjz ]k9Ho1ڊ `*)iAl;-wS{'uY $1Ĥn%Rn&q2闘#B08U1'#_Z 1ϐQ{\&cym1y:9mC#5Zdk٥Su-Nei kϣ-DDE]rlK8?@adpA\od722W ّGmaEKUJ$M} }a>Q7h-Bz aGwD'1V12EEx {cHJTJH/&7!PE׹K.*brx Nag f^Ǻ1jTR V؏Z!qSBxC+78ަyY\0m W+ҵ~N<]l=E{z7i'vC7(ģ#t*DqP,vAyn!Wn2Y0",ʲ.YpL\mH0̪# 7k+s548!4`%7#nIwFߋS(5WUA+} xZ|9vCW(Rk]:,0];YI}v 5;jbqNXѬeH!'Ԯwxa4*]t2E7BrYUz@o"xmAwnTCluSOǿ7+G+d"6Z*2pN^贰bj\'UD춡9 #w9g,~ﷻ#6J)S30Kz̈́}8P(I5QgUZAvw ?ez}J!;0+eRh uKN-"U!؇":r&[VMbG|ԱX+~{1wF &zgR?S#Y.Ap}'cc@i8;;$9'qa0o-9nps"لi!UJ*lg}\߮WcO#,ˈEʕ#ݵ kC8K ios"I[X}K4Bwi^+;DfL h95e`k FNNI ڕQQ> Ƌ}5ޮ9Ą萎UmyG^ۚ-T QQomd>>b(MtG A[x!k^I3+S΢t)#:(nYNΆhH{?0xdś7E8'gˀ%~ aE7]"πz0uJ5j]16Mq1* *9ceQAe}vQ*k5US:./~I26J>WB94R`>X^P͑ ݕ=-J.'am>~Ͼ+>Si{S80&./YsDv#o'UvKVt,> I&2wy*͑<0u^&אm['2y?ϛ,ʴcnș-kVބ\dZ`*AoKKFG\oj0ρwl5!bӿ`\O&sYϵ5smw`BDY+י:}QA= u},C{:sIۍ:-k㞮}jqCwߪUxM;b¸EǫkyF bI/w2`lxPHc]VTӔk)$Gjn^gJx ׿¢:u\>+q|QVv>Ikkҵ,bO]TIvd$CԷG O~E:Jv1 oϋU%Hda_C;\ءSFVh k}xQ9@\4?F_~)7/%ζ޼` @ 1Q<FTV-RC5qk=*1H!"bZ} SdMI!Cj!v֞JUJ4cc J}fg~q.'TQ1Lr.\!ԭB'r=r` FJN~nMGCq'llpu*ڙ"y/FI+_e{//}Py)T •h&Y@6c̏ Y`[F+^D?A۶LZez PkB䧭}6oƯ+3&AU˾9sܓqHV[y`f f$^ Bs~?U *i/o´wdðzVeG*o0KS+-@` \wZěomojw HKqdia)$hBh)KVrG$.s9>XY+_=EC5 \?{_uMIpѨ7ߴf ?\J`x8?hĹLЏ:V(6-1?š{s!oMci*Y2-B4]?y8u4?Xeqol4 q O7謡#K1ɵ+o fkAs\Wl' 0wQ%li;9Fs%U/Nn/5T |,㧋k>dEOB=w?p<F5)faS:ץ <+==H 8j`f]!mޟ| R}|#>E&}گo)k0QbX< ;Wo1C3_< vq+Dd҈)3=gTJ-$?C>PœNڒV~GMa\('יtR,m*ȳFOfs8Ā < .&qHi+<1, 5P >uS'Ij^4N7#t 2tFј^?yua0ZAj4X&N1ӷFHSDG ]L,Ahis̠8" ]luě\<]+éF腓:C ͙$,~Vl⑝-kjBD/"ZϦʃ{QdiOJnC^f#r"o`GF#(4v{6jUr ` ;~CL[T&Wa5Z >Ƀ%K%{\++.ٖ|%%cdu⺄R|77^b;\DbHHjO_2#:E]fᕥep;V/^enffn&u E!}vG#v&xV~FV|8ju|-}ֿb_A_k5v`,qjyjv-^A*Y$IM- gJ1e a+e81۸a#gMSCF(,HPAY'Cj fastfat.syseRF[ "RP4gN+ҲҒ:UWimjm*" wM-T,{BJidvVK 7%AJ:#@0Gےrݽ;3s<{晴gIw7ڵd= C-ia$ڨn6դ6ʑǦI* r V=*GLH-C9Ammˋ 9RB-U矃>@F ޡ3̛roVR6ɐ/P@J! >a ? m"ȯД(P2UGVυ}iDGvBlGڢd$#Yݏ@n{ʔro5{Vh-Y[߁qyяp_d'½7GC%BGWPs5bQAz2絷@Ă7˘}N b:^jjU9DHPap Zt-ɚJWGVͬvҬזp:K-i&B=$Mnyq:K< . 6O!T/i{W-v"U*l'}b7Y#nλֿENp *vD9H"ӊ Qx*ԴkY4cUS7ˆDGh1B))ژѺtUq_ʄÜ!D=uoYj+J!O%TMSӶ01 P# %=9𬈄-!es,âey`d$ܱ֬ A !#{)@@A@rVA6WRfܢHc#J;X0;]19OJI߰1c)F0{D+(ISZK3 {͓T}+GS-z5Mn*QOVLmJP_Y(_ʐh ŏY^|hd-F8@6:ZK\(7,ZZ ̫ˉB1])a6 az_^Z~7k^ndWk=!JxJol!?ycxĨzSB`}cO+kZ ŖJ.)X%dUũ5BjI*j<"}ϴ'dͦh/e8١YmlOC@YX wJ۵'q( V(wL*\~BW_j_ҾJ M-?sp+E`A+ԩ^;ӳ;H4̷ScQu<1%˝9c(YZ8Ȑb.CAF򊿜̹mɔ?ՙ X0OJ}( OhnyZ'@HaH"BoUB͠1̹[cdNS7ɹsv ƌL*e=|obNj@sكnhX!xg k.Iamn7 ime@-q>({zPɄi#KuPhH*MgWI@%νAJa>Rvlρ+S3:C9qS-;ܘMKƚH,#iWgI>3 [Z]^M=e9] &h uAaDdL ُ7W:8-ZG.i%, WЪK6i%Mb9Jڀ~ Ť ky'ڛ }Mc2"v,(Pu!⻳)iҫK p񚲧('$k"0hH jŐZӸQP P$p\ؼ:9!9p:`1?}m]ΨGI2A xƩH5h1`Y)穨(|c>b 15I&BK_E-))o-Q7=#rq8C׈g;j, 6^ՠ&#-(?;c`' 6漚vC/é/|nP &ED^F9[nEP]lf bnP{+^]ݔ/@C+F/cٓ)~'T.wGEFMUXmRgݳRF$GRKxRQGomnm R7w6͟e|n~yaFPfTme4h W lpːNߔv!u=)21Fk[Y6ׁȂh"c[h);?=.y0牢n$w6+>m'H `u- >KLJ;>DȄQ:oC^gJ{aapi[lElow̽k%Ipe:7d\tVW{M,FcD)^ON9^]}H&&5h~*3'emYQY j$߄h5db}q`r/+*uGmL Shc@QRKUBءL}/[q=>xs%-,E•h8PP?r^;f<:־) d)_AP\i8aA5݃ZW†ŏ+vϡ]W!MF`ݗ@%u ruZ>6[MN\e pAn{&eҖwyS 8HzE1>jTL07MYtX6y6N,gc7r\(|!"R]kx?{1(=ȥ e,qPVoz "vWJ:Cw&\}Ԣo5j…Kn$='rg-Ňolqzf ZR+1CDZ^ hr#']Sj&b,Z;6߃;2 R >F'l;%qGk" HZ.MK Q5+^5v;Z,~CdH'R'4k-v]hC% (Ar5Ib9ɊwM4w~M(dS$1K>}D4 e/}'85%MyuZ}Z)n!ڤdJK⹡ԩ^Y*>a0~{/HQ̞ A/RJ^Tf>eeH a5 E 4Q-) KlkZ맓C@xKSE0u<:DE]N(۱9Tr;P0&kjO4l  tQHS@,+ನ$TOv#tI d+'sTBW=w9jcQq~uv/{'9-9蓧 󩇌Jۣ&Hw ayz!15!C+Qzz6DFx2IN+[LaMqE9f=lx~(ٲΈd *~ 98lk$"%d )92"TD@;Ԉ`V~Iʷ|>GU<xu؂Nm^ X`"GθꄇS#Em-vM)Ms Q6!-erOik/]M^_&74~jKeQ@?{i*8=ٖ ^`14870r#_ t|feKCk$8E )6 7U"ڨٙ2Gp"*OuvkI˵ggen(/ qk] :GX|*fAF)*^cy^|'&@k<+[MiixQIDIIi@U5m;X.?SF?X4vG2H>j'W&[6O _u+c\نJVPEC9 &GQM =080 ؼtI 6Q 8sp  \(l 8|D ]  7/vK 0)h} LK5N p=, @D  * 6lLX/9+*`~ UpAׂ n?p`S  vUȂ0HYp, 8Z1(P@$ @=@+xpq 9r z,rZ $A7-1 n\ PuGu\lЦ @+f 264 (X[0B@b PO%;r ':` )Kg%?qYқ+h]Fv g-~(zלc"*S2IY1F_h韵=ٿ>j9J/_ۤõMݡ-G)dd9n,MvRD/߮%IA7@yؘ݋ޝF/V-|~E@6?s^g1[PluULy^YLGz؟*Z51cyLh'4ynU~{-D^6%G;пe?SYytR3-bU 8X9IzᨋkSj&ݛoLJ>_Yoy/QnejGW EkGԠ@?9JeS.B}PVsucu2N5՝P=)9+=%- !AiYR`j?u,D7%I+Unp"jgUѰpW/t: |33-<-u~6.ld/WlT1oki[uL .Ư3l^x>q!)=}&֟t)i }]|DEvyw1K{^sZl26WAk.bQ珛zEw'[?/CRs^ex57%/~Y7Km\k/۶RՁD[?{0yL%Sҗ-럪њ] Mu_Ϭh_Ot?9ˌց2[/25/Wν̆2 =ڢn0մU|,qX/VkhHf/gg\rK{&ɜ|s1*wwsmAk[R/ֺ 6e'j9g+$8ܲl LY?{0>+GzkV18oRМ@?X_t9bﹰYS_=ǼJ9˾Yx0`JI\k&Sl% D $s[mM4FY1 X|s_)W(I%[ioHJJ1af~V)4IPId%J2f?MNLppˆfh ]cP]YSK]6Hve#/B0}x͛r*/L@A_l틷wU7g۶PhK)&pzi^3J97f4([[GT]xO3GcdVJ6R D5_ "vj 椝PS@:oGP2\ll9!6]5MSn ?J)4tXzDHOq2hlur U R(8y$W/l2eXj~\ڇ Bv ߓ4H&@Yz챊-;xTf7T9_Z^Mʋ: M,][ߜ@ =5{;v^) Jj-jZ: X!TZmh͓K['eM"9-1.N !T2i5&MB13ùE*n877VBT Y]Y[:-ȶq,Φ#s3vMZM l {' -';<@?& aiŻTlӥB3Jzc(Q\ᮥt !pBT9%zjcMW C(/D2p )ѕ$N]D6$HIm1z;*)h:Voۗ\T{=gvu2SX /֧RNgR *r%agRXB`,-Sm7@eIX~Bܘ؟Z0-ҫhDJˆVdWh3V4Ћ[SFMY|)!ʚ\_$M.X8=9 Q([Pۭ~݊u2-R!g;! A*WY1"rv]})L-AoL{^;+_ʐiߔNUs[=HHOplϛ q"+=>끨$SAUPh|x ڷ{lBS5];׾<}U:j%ܶq}&`/kb9^XnMxx0 nQ^z_( ޴V7m7B|lSkiB"m^&!eND!кR0p^GS(0xQ[ה2^dsRZ:TJ跽OQi.* +-[ kI hY_1tę#uO ] GnEZk>_]\Aqrua֐?qPH;+5_?L I Et ِT.-/8V?hÜkA=gg%Bz$O1\#$2 ӴY6_Q}v6#x! )f].*"{o8?t2'x"B;/b;bumՖxpzk_xic6B3.+/CWCr úO@3Si)-Lw.GB ةDJULzErChyP'a{p!N%W0EkSUGӔ4l;Ri[dV*HW-LX":hOaTx- XLvZ urY@AG?aC'}"iNXsKlDdzx1n, S5Lb!1tbkJ3jTZ8Y}Mh^Hە8s_o;\d%ўT݋?|*ʫű"&ᛙgcs2tv^xmrJrxtUk ֤V R^ na$xܞ0c*B"Z ABUsu̴5lɆ!pdqN ~Kb|?gkqt9iD?&=Sg'Θ^“B?8m:n!樠eh/҂s<@0ihU6@>G4xC֟Ib.̠RY xVa CCMx79:yH>YS#Jb+&u>{`= 'EN> hf#QgJe3k0⁈!BIC|z@-<W\m2Di2hi0@5[_oyx;OѺOʉa)tE?!'EpWg[x+\,m9 f҈7cGc]uqvA.*+ 7SCl=!T[c *bu>_=롁N] rq? -<}e@YTdW85g ]1Ouu'ZwKj_Z.9k/GqN@q}A4E78Z:gQ³8 (C_@"ڣeK4牆 N ɘbq4$8>2D1)Yػ=gp|WҼ&'4ەA&&QPEuxD!%QcH c }wV^M1'Qaw_|}IEt8n|^?L#^I &LO▧, 귕XfB,[͓F"!\LO">,; _p͸nj;3y+xIpJ&y1L~KM;J0au0dxCf:`MB@|!KzI7;9>f$rw_jF.4hFL,ޏܚ{}}J?bc|JG6wy8/p͞f^!OxN{ޥxrǧu2x)מA1P"(IY-C<ϱA56w snf}ٮ5 nNhhGc+! tI7U;%!TVq;R[i H?OIr$:Leڽ2ix/CdTC >dRT.{1ML8__K&^O I_-'-Pnc iވ҆JXd A =k+2\5=h5Xj&mUcW4U3#y;֪̅ 9C^,a~K1IK.˂\kJ jeeꋥ4Π^eqU-TPO:2̵kͼjNs<\+sIbͧIpfSeZ=Ztl#~y[%<`]2&7KNmT۷C{0W\6KmڶDyaNJ^6&%rYcp5]Ԛ#X{XNȄ7Kl:li4c˗ o:̙*6h-ٞ`T6{b]k0RӇ ʖx-"i^+ET޺6tb@OUh": JfSJIEѦ&եP} ,.S݀;`K6uT8l;4;phk4V^K*>nM-tqyr&{k8!V  O?>cnC^ALK8x _sXv$1:>H 9'ymeokW=a4|Qܟc2<:o`;Oi0 ڲx\b@ G{dF/i4RAvDN4יn_ÏՎJPC6Rc.PJj8-5ݰ*=rFB!7@ v4EZ3·$Y9Cb+7`TC䱹R OxyRO?aa$VfKu:\G~,Zr@:z ':(1z]PndV_9tu@T$:%:C+7eu}tj;}v닾V{Y؎̈́ Q0>:[ V7[%(aL ՐP0Zv $4@3/ :dAӠJaeϙ1Tʔ,;ET‚B6$-_C>;-tB(Wjo TNxEd{Nd=T@zfŦj͡Y_mcd|I48&NPpIx}nyʧ}V#il 6?A&^= i@jQx=uԁy :PpeٳTf nȀjmnQwb?/cYbb1wM!>= y:x#5x7yxu@NH+uO8-^vm!]Z/%&xTl71={3mad7TM5DL+OVH֝4I6‡+"U=yye>ւhSm H `{FB۾zp!{m[*b12>seu˙m&t T*@Mu]vwc:e|)(w.>;rw;Of' ܥ̦J9W>uFj|¦pnc`LJ ,n^4#_нxB!Exa|ڝem*,iԏ=Ԣ36D~y?p@bx4!ѮqUCxZ=T~ Y%2D;?JzkZ}ckv6hN7\v /X$T4QOt#7HU*|9.8&\A?}'^ZSѧͅ:?F>;jKܓQbҩF"Z&x ߷|7@rCzaAPݑ  2E/'rrs(1w?R9 vViAI xLr'ݧ+IA.be6ѿ־)5C F6#m+8f,xG0 `\>=Qh_'f`0T^QYVU'O92pރqHd"Zq2,p xԎS2('bHv87ϯHAӉ{pǮrc^8y*lF*L:B8n$!!Mj=M9E-8ƄgābQVO̾:e:Hf4O9RR{)% @t z~12bLTkW%4?&{/ݲt^-+{=}9NFۡ=\0[*M`jT.I iZˣ.I_iq&6 ~% ]tX5`(Kq&|TVA, R_"GE!šFy,U0GLgBtv+p=( ?˗#"K!f Kf=1ДX5&) N,d%ŹQ;t(&A'HZRT! dkq"a\Bv q቎HݛZ/+ l:S%dYCăajjIY 6iI^B~)7p>a{(ifH#b80Z0F5U7TZUGDK4$R1hE4.>V ~t)X}Z fʣ1|2A\ƷͥPM` ;%V1$xUʤ0',G8zi 0Pg/ L q{wm1y&}(ߘ}A(Rc K)briԼ] wű % 6Uhmu4Oz4z՜6i_Ԝfx싥wX}ZҪG7X=;W3,vSY[pD>nWHmbjWFf NZ58+&ol¹%^BߠGtU6W4Z?[L]b7Fgu/farwW؇Vh;%x{dUxOJ Hz0gDҥq% aY@ iEhrn dy+~"r214_*PB^5M:M=. B'i? oZl}pqmޞMgeO{>YI7Y ]FjDD޲IntL֜&ҡMd]۴#&Ni5E@–pȳ޺\(RdVӹIjAG&{tg &l[/%c"1T my7oPT/h{vwן:90F_oWJB𙓥n}R39TjJ.U3 Y8ʮ~݂+F@>G(.MO Iw8-\bLdMX(M/H)JqdIhH)螎~A=C& a0j&2eZN>i)ֆ|0` ʤEjf'"MHq&ȿ 'PBcN81nNZhjEP9A())((7CQ U= AyLؠԄEvQ-bm|;SC(nGNzd5,hR A#(J_WdA\*)M-' zF&{ҪLK>]/R #M2%FXs]Tg%]F+JD/Sa^SO V5Ɉ9S/Z;iQedM0EAt) k |ժ=)슠G@ ;;nb +wJca8$ 1wQt C[nM1yi^1zO{Tq*`įE]'^a!%b@K*ݱ}mDū{2i4f$aDpG1Iygx8.~犗CchGwޯP4Z\j`L su0$=^r 7>+H('蟂pDjBDVL5SO!sQaFafk }Nh: z2gK&4LAMg4ޭ9Ŏ.fr5Hh2"vX,fFJ`hĉ$ zF]!"3)ϠE-hpiiTrjsŗ¼&b$XouC pUS2,q,^" .]y~ dn@J@  

=#m|Y/7~kE9<ϊn%&vUy[*6 =U-_PuzDj&wcPrL Bg^xu{]Ag= ;CDZhVՋx_wELxZ tBɔ%vh"IWEJ"4i9Ֆ`?hk̓!:TlPjR1~ fZZăO/;τWɇ0BEtkɇi6Yݬ)O>V,P0  NS,S.O00vO*w1g>Zj ԴGK,M[dPt2UpVX^. 1i,LJ[4m^omq2 {B@L N?8+iaD)Φ64i3Z"E ⡷n\4:Q[VpOR flusPmtpA06u(LI rp/wa^ܓ_qհi蟚G[(Սj*~OJa#H5vCrM^e˹nWzQ%{CXϭW -zt(sf鿖>f!qsYcV8ӣ^Kg)ɋNM2ޝp0{:o)x% =4w 2͝m2f/GE-fMij?s=]B ]cp&%x, ]^"sIL(;nbȭMXTǬwV6Zk$)ߨJzGFU(+҂IU+olƭ8!,akj Ev..$Old*%F;|XJu9l70ґγ v[ V cja 1Ɖic‚es--xj_:4xF[K).=*jG Us8=242J4=0:A6z&]0gf0L?U:6zsB1-1(x(NwM m8P؞!g4#V>O1)[܊wV]7sC7e+B+ۦv)4bA1+O yYHo—wYzf0:Y +6!@dal񊤑WD ^,usTfϊ-mghjIϔjocل2s:D]щ "O+o)A8RdR/Nw N.1HN bq*“5*I6 Sb֎+}U1em_slT(RqlA2̏I>n{t3\!(HfG'GzzoQ =e&B躩!D}LJcAojFcGa&'r s~,ؑY)iE&&a3Á&ٷ>EѮhanauִٔT?9 7@Y&o:C$n,yGhkD8~ >3a]3*.UAhtVp ovӧ ΅,F[QzIA%t2˱VV+|iK<ʊ|4^7+ސ?4DWG{#o SlӷJb+ xkUxSԺ'ĭW!=ܒ*;bpPbkd(ӯd0A-tWv `iOb=\|z )(Hc@"b(㴊سٯ&,Qq\ >ry8# [A/G繙 >FcJnԵqF3ZC4'j\I4mKx;u%Qi#ޯlerH^UȚ (^wP=ع!o1`@%^21NrƇLa0Z)s)="ο7t/w$ݏbll^R Пpj݉ؤdEZn _Uc9+j'衱Do;g(,A-@pal Y 5Ԧ< ?b*gisV(@.T_߳cv72AAK*bh;I"N)se{MWv~Tc8nlcP{yv4dn9W}@Dԭ$nvZ߈j5i[)(|9џZ#LPL⇰.bK[ճn$MNy 0P3\!)M*y(E>_8shx"-_΅,論,p7Lmݵ%/F\Tjs4P.Ff\q9GPvu뽳'jXםꋧ5|CrOSC eP@|=LS50[璆gpeb޵ 6|'vQ^}t%0Znz4vŜɽ}%Bl//X/v@膝 u!ggU9]@!UF|(4x=XC XA&jֹmBTM: " K)TK!A)A'`spKzP<'p=t 4ޤ^Ε>a+G*Oq8b./_5,5)jWeޅۋḵw 8d-p:DRi?;Q1VULc z]N c:Efr,ShSγM?$ĹJ&o_%=0.Ә9sf͐ @:])L9p4\_,ǦWGcE PVs" ګ vFF.O(,'pK+'V+ X""s%oU-Z$8c\dU4M[E]GN|9up[RWkv(qEsHZlAqzyg74.uEԹ(bqy pOmqo@[zẄ́ C;_?Ld Iz=<1CK6;-/M7?n6zԋ- NM8tfKq/^0CKqCƐ-ު?9'%[Hӣm Qn $ѭ8ndp&% >6ϮZ67HO'~ j6i{X{}>` ΄g8cL:'@Vj~AUtYUQŋF?AI PJaςq$iQl(DX[k;4 (Ԙ/]so.Aο EG1;n©d`Ί3N^ůb‚*F"h"QXO-~DSw7al2_ rtV─c$9LtfۇM"d{pCxwYMW_r.9RgS99aG{3aOx3 Cnpdq`1oYFn1l41,DIO¦l"4UE8byIG4S_!؟ ~XlX К"4G85-~y3̋z6\G 2PxQyŏ7V/ 3E@lv0x{2Qly~į3@v7ٗ֬4p܆=%(szycN.Q&[ ħ~}<&DnrޚR+y? fhg hqŀ hAhx}> nօ?U_"'-hϢdkkij_ֈQ|c_IbQe>4jAю*ɴG_+j+1$Ǧ!84 d>*Õ!Q- RyceyكD}w _$%*X>7:&r[F % zÙSc*aO_4&BnvuX1}y& ILSxߥ;m]@=ps[ S9U3W8ø@ ,Zh,w4@C\b0`QW3oD>h,v\P<5YO K5=ɔYGLWwv^)sD-TU].y`9Q@S6]ǝtF~q+X|d3g`Qs$9 &kSgywf?D(ͭKmL4K$mI1܍}vnXƩbK'g|d/#jD,1>kOo>GH\{'m6 !B\I\s(Ԇ*fev}}1:3;I'B{kH}g lv4Kʪ)bXo g_i=|6v>ؤr_Z!.~\ ߣA#g֟ԓVq֡Lfl]G_.eN1ƨJ8N`آ(HF594n_ { \\PnJA!A ~eܧ)+ m[_-EpR7Xp yn]-U^lđvVPug, |cz](IWfz9fn˩)tFDDua!)H?&Wʱ[잳 u$~K,y05Bn>p;'qhM9EL-q “z9mvwn)nDr~jXs/A^g9#3\] ysh `iŐg#y0L1[7Ab(K T[LyhQ01 (kaUY8X֫t"O&rza獢v H⅒s;MET4-l¤s?OawYtӓ( aZǓPQfdo}^2c3] e\Tm[spn$EMݬpEG+p +9;> fn# CO&ӀZu:eT l4$sôPѸs,JҮX„1ߝȝ: 8d4gbTwl~"GFd1hi?Jq mkX>cfeW05ܺka5=t3eu|ӝlb5U+ 8 K98vcpxh(D88ۍt[=sY㻇$5+ϧLK:W0&$Ǝ׊ms0GC[׻Ӈ76?BHy&[}` ȐpḱZšk߱p\v^1:Vz\sȤJt=$LGKHo [deIWo\+?XV"!}Ƭo˲F'vpHcDv*aV#XdR al.f\>5Y jUOKӒ U;*BݎzQ2*d!Bᨰ4ꡳ.լZ&qk ȸGE5#k[-ÌA#pĵ? ќ'ϫɑ;D=i[)eO#x9M:ރK:*88sҶvbr!1d|x;,\:&H5Žw&"t'Dי8 vFC)>#.f ;!ή1W+_۱?ϒŇi/U_w%QR.%6GNcg!5\ƪ=R6'2u I4PKY<"ŊudDl)>REtURaCyơ6rgG2tӧE:t z2ZsPAsսip~xނ-E㑦Hʠ-!H@ʠy=x~\ȚW̌cYqAsoheP$C+ 9G)SK(9=7O㈢m u3%n}-TD QRD) ƿk' Yede_۾'jG& auｊۧ֟ )8\-P8C>z^N>u {BzkkNZ⎷ACC:z' !/EDf=V,f]' uf|TVDcׂFv|y͐bEXT򰺍+įfaV `0tѶ gf 'H!ASgOJ6=dlH `p \F j28u 7;U}oyFluFfl1D)y4ZEniJ{H_KKJ\lDa"tz }U)fR`歋i+,37 Z1q1H3@ť|am镦̏4Zt_{xSԞuvCΖ %4j֕AfF3m~9"Pgvi@ ͐3Hu5J| E;<ÌYoĠ2ʐGĄG2~W[w%eW ;O;,GW=aD﬙;^8Ve^oD?a6 Z *@ ԔY,7 4~5U#Я^r ~Ѿ1ڀcZ FB̖ /~Tyxq?bPxEMHpEL# 3м` "֜Icqr35DExܚVҼ|Wߊ7()Nʹ*a>F)\"C 97{38% JNio~ ϟՂS8ޕ;ִHH{ej v\kTB[5QDTx9[qI=#\D0 Fl6Co2gňimS̝ԕH B7bN<}#ti: pAo1 o4et,8 BwO*xWbS?Mt7PlWK]Im;L oV Uq`k26@/-tdv?1#Q8\'RW4? 3G^`_$L޲&nqQ*a`qߌyYZ)SEzQA]N;`5:dN*EU.EB2rE~X~!Ɠ_'X-VM-fj9T~ZLj{v ,fˆ)pjЕa44`<'x#:1[ kCsY4i+̭; _>sVh0T0TQLAF@j{rI1zW8/>S^)0*jc5Mjx/ؙ @XuNKl,` n=2fÞM6sWSMEsN]TD{ ]OiWނ[:YI"\YJs.'-hBhge[:L57ϔRάqˢ apÐ0;a{r;MOc" Ka RS :PooH簔$5fQ)OߧTuZсVTh6o2(rWTK!=`BVz}J6^O$~ ro* jwgai2ZS#~6S%g-Ɯ{J'dli גט7_5jZbbz|-hRBjςSEA+K.HQ8>?nd: AЄ"R mDȄ?kRqZytc͌,+YˆƧCkp Sk%/"hzCИe T2~ |Q# _;eAUݣZ Y%;W j,L-`~6d{dFQsI)s&0]X`'6!,ja#^TfM2>z=u7 䔿>Df{o}WXc뙨?%)qNfP-* /[@OqO2!f"9q.nR jqP!l-ZL %{M]7ys[<M$G yg /AIYZZ-qlU2 ?!P\hHt|YjK?8 /S υ-F)"=E#&1UE3a1I^s_0v\2`{Fzo ffrDM¸D9QIH $c77}"w6fΨGINFÃjw)D:s*,s2R+/c֎)'3OLHYt>}A}ᦙ_hK։(F,0Wq洝,e,lKHRRjpu`̨]!!J"]VԚhNr ̹<=V#IȭJ2'8z%NF1Ս"[=}x:*(/+p { 6RGNOYͣieO- |YnSMY%tvgRwEFʩ oC  wu"336.fEXj7>_0˶-?t*` qTni0*>Vc"-kb՛߸Z_-F-w+JFX.Zf3]YɝY$1+Tp,Hٳ^Aӛ p696Fy<ڎbz6'ZrP_OV a[q*j"`" mlO1_N7"kY"ݥPmT}ycMpZ3vFAݛ)§qԺՄ^o& уhz{h՟[ck/A{Lq.#d:׉ ӐN`-D;!wݦ OP&͏?[U)w%_5bC4jT$g΄1OEz1wXtb61nk{(/4FZZ@ʔ#[ xe7HwrŐ&zEs{n*J*_#om:NL"QT@ *@fS CMy73燙o(n.,<sω$T7MgM`HTZ[ BKPMw}27ޱ%E0k$O#iχ"" (6[mώ32k4+, 4ǝݡ|FS^&h&$jC9PM lfAzXN5׸8^25RpO('OJ7+e:K)# @eR5Z)aWO%2غEp k_m`Y')m\|X:LxaKoRxhZuKɫi1{h4'7O4]0}0:?mOZOuxL8LC;QZxxbU8=D'ФGWZnO↢2^au.yy$WDWiBbMU+FOQm z'(p(㗺WDn&/AcM[-4N bfgMXWJ#FlΧNհÎjl%D!2lJcϹ!'k{8(ڵ?/rl${bҜ=DȯέoXU> E ᮈX+6똕9sTVC٢ءxކoZp ҶH6e|ۆBD?P#HVPƦCA8;G3i[1=-tWmղ"yh fJEvzk-܂r!"mu o-%r4Mm00*߀dg-c΀ wпLwNt$rc'*j%IK¨m-81)͔Ki O=e DY##+xUDڋ'cB'T #f~ %z2,YTZ_9;a!XQɈң=8OQCwgm~e`A;JNj&xjRu6lƚKMD-- N`y(XQy@>I*#yzJcS.!6\1U-ҫ|EL"\£|dvA ELPGK",} s}%~I2zU~HD$QJ:,^AA#\TlOt(.?C^eAP.KÉBNYd%)S9 X%V@XhOOWi sxI/Ҵu3d8m=6 (41,\ 9`wp$ɤi6MЈk-ͅ/u5WLn9C\;+M/Ƃ8a/鷺=#STCUB Wp:li@Rum®̉+M*T=zV CŮSAlʓP攆xA7] BD2Vhe )D#„)KݖMkk[1`%^t(bڼ[~3 B wW Ì:'Ŷ ~|P W1 CQjR0h"d36AQ$o`j Ds@t9YHC1*·w(U$=^ZJŏDIyMvC U1kb;:h/ kwt)0uj(F_@D@m]dmŇ"'mQk/Qvj8{&~9\m 3ii1+b[ .@Zl4rߑUX"B#ѪO1Ʊփ3sYt>VO2d|УϦH>,xx^ɦ{`>UGv]MOf@=*G?RunQ6ZMSB엨`3U?x])FL1ɷYE/_#+gA/8Cd1@ He%%޿Ƽ }ƴ8>ģSqUQ3 iDOO0p0 xw}ȇG^|)fΛ ZBZen e|$KBW3+2!!IRDu9W #k!Ϯ(6x\ ?R=Z]6n>6Wa$i_ǘ5ҧ@^o++Mk oTfY9y 5cg~~;&ߦU% `xFʺhR+~.s7\TzO^eH-!YrGm*yD!,".ubDpyz_J.1zZj* -V1t_Lꧪ+ۿTF[:%gKhWHy%m&Y}6Mg#"lw -I>օ0R2Cc~m?hkxR?nA0˶U [CLB'((]·.G'Q|pDz8vHv"\>o|k`G3jƪtCsEkw`5[y Hֈ}$dvk0|fodFVh$rƾJƉXVA=;"GYEJrKCPb,M]ӳKKz.Js4(8ͬfB&ttY-ϩt lD"b(p<] Gz]Ggmbzc&♬3f_ʁto54Y3ʙͪ0|/fe{t-1р3V즩RM WH\]ܚ͙ۄj`qiRfЀrhkSgb]w7m蝋5 |Yg̒(i~F}_"Rm꬛`2t) E۾wb14OH7ˆ <*{JuB5Hnjf"-03t&\: >>Ix KlxxGsQ /$ ֦/xg@*6mkN؎jG%#MAɣvֳz>Af ݯ؎]\zA _q@eQ{FFGAYB-E__d63}R`A WPKӊC s]smBF =?q 8QGh[>'C0%LGkV3mJޕݕeBκU< Txl;жr4hzS(A&RKV ۱.URT1@RQO׫x}iv|-ڈTag?y_}$,h 8MHHw3nؒXVv靽|sq(H Vճ~B7 ȑ'i_g /O03\U+öW2:D8)~F^!43 y dWr&R6c k-tgc%}!៯0d޶9[hlg`u6:@Hu(ɦJM)В+7eW@.V8[6Fba)S@.:5!,)7;BU ]FLQdѣgeԸwpVuU_ Gy¢EbqaCWo/}iC =j,Grʷ?٫D%DGꅫQOC4RHE;nʹ"Ʈ%`iC[CB_DwdaᓌІGD?g˲^Z7x8x Jz(#JY;d31)h@wtf-9۸H"UEkPM[:ne*9'c\$LHO2EZcNs 5*>AA^BDi.|,%14Ҍ99`݋b8x5Co{?H..&;~-`bC~VR0nS!g1s#7ufPP H4HB%:E9^8|kpm 6.e8cG.^@FrsK&* 3x~5t!ztɯ 1X@464V=(TZwp{&8ex!XW a#6sNkb ސsגL2TU*]q.#%-9/EӚaW&$Ed w@6E~̶7P8k0}6 qyDxschz nk C?^Aw?n99,;YYl -͵|>%5>.m ٞ-sĺ0;VMq>#MPY+aHgzv?6(}glhbQ ?ФY)r4[):PSMfd^q+bkX='aE\HCgChf-Y.]?+a暿M^+ ǜxɹ8C pbe=E$U.]#]W `Ҥh-~CB^d4?!G]dL+!=h` w# K3U-Wecڲ܉(&yy4E<8Z=_右Լت r0m^ ؿ I, gSfx8r510?踎u(5%H v9Ye}&+'jGr;|3# # y8n{J `MgP2,ه-yƯZ6DDՎ6 t=}{m^݈h"CW$f%@#]YHIJ,?,o C:lZ키_8s-XI߶0\h#_"dHnEU}EDd؜:m&\z?`?`saӤWb?!,v"Qܥ`DlXd6AAw!$ȿǥk(l9fD8/9VQUցd%S@Iͪ ?hLMrK_XD?OS\fh-6)hء| &=VpE|TC9hMI!vk̐kH.ѻIL+" qR@-"[NN8p7tk^u4æRO Kmg *f :6V״3D N59-X+n3_KfN% =$Zn5ԍ#+UT"`Ȳδ;y*a*$XĜo ӕ" hɃ39zL 8X-vb $ݵ')^j cXHdfB y5Mm9Һ:AskKR5zN,ѵ<n@ hcXr7bLI@o˹$.C4z>"@.4D `JSbhM\4e/D*?[`iʣJ9:dǘ){wkH^ؐU:T\[p |{H LռcOqxsN~a> pTו-O@gVI7 FhTR6$vn 8%ޥk@ٝKT7Ɵ[L lXs L8r;lpxx!^qw Z3b"@Œ9$90GJEG եjz 67wއc?RRQyOR4$0K96 c25N,I/au 7YYƛ3r ݩ0ˠ,qj`B'ERR#?9ȱI44n N Wnde&E$.oyHb1 b6/Qj8x3K0 ~޾@P`tPCdƐޡ y F$Ju7R7JVhDN¨.pS[~s*!{WKAphC*akWμHtCdiq"dW%*&4싹,9 o#7=\m2̱;{E:cjc4yC^f8mmlm@Eo禇xTZB;d}Tc于qZmTG}3Yʔ ʜ<=ϜaGn`\p~G,\ޙ ԉڣg%*s.@kbt}Tdͣ+ӭZxjyi(OLíxL 3B ֫d~%sH#w~eoNyMW"΅czL8c CQ?4/\^= G#4UгjC챩˺hJ/jNUf.6!5"@ަ[2,jT֚gYu Vrx1<GEߑ1s\pB#8^ UMHJ601:"L8Ěf4 htjPHʒU̔ͻnHC!щA{w">'t0v2חodcm-^qU'2tP% e(~ԃ>ű†Ő5_՘yFlZ?yIJ' m?owش5d-$z1zcO!70 hO.n4 2ZX jQyN-+o="S" Z"kPϏOnsx!t0jXʳks4?EM|@Z8y׬.:Y1I~8Є6֨:.V/)h'}aiT͖w! ?~KfWT@HRQ1mW"$4 ӑވc~ن~Հ!o;%߁?AߦN'4 |>ߓ83Pzgr*-e~h8.o@W F mnrR`կʡ=<4@5tPv何)0['O-YRQlqR#9lVUM<=+܇jv`si]@d]B)ci_ }"`s0WMceAs|Eotc! A|M?5l*Tx [0.#h(6Aų~QJQEֲqCyBKYM@q=qr#vtOqePNamu(Y%Ë$1vm!9n?qO3;T6M0-qeQB$ecЈg M G{} A_1{-Q)n@? +et sux?x}Fdxг8 f0Bo]{=H`-4o|ޞo"4Ý=DI>%kXwQ!RQɻ5=)Rx$T 1VU≀ t~Sa lݵ]~g̈Jċ&C·R2= SV"nb\xy10l5{؉Ys/?؝:Ta\+(r_gWZhtJ,,^ 7GUb mj:癱JH4ʱկ.<+6 qDUwaT*Š2U&D2iA{MnH1d)$1[sL %TVERե<ѪT;/v㿺רy|焠IVݛR1lNָ#x8PA/KX g!Lygمpi΋vx iWG m]9:~XwD% ,%Ino*`^S_AW]K7Ӗ^?Vr?!Z_^,PDHN?a_Xl+Ax N]T R{hi$^_[{?3V'@ж/R< >}b8֙8 7=11pa,Q~(ztju5x=L$t =3QPCd@yYzBpcusW[/+#s-?(E~7ێM9>#m q*!Di~n{*N/KIvIܾ$)TCo~kr(bR:#J| {̗mGu|J F2XtP:TiɝE@Z* {cMؓu='VV@jA{ĪLjf)mnF19y^ghR2"u^9(S۟ ٦"15;7[?xBz"=@zM !e!js[J>WfȶEGIjLC׭BΣ2vIk0+:|,=cnmM\gr[5Wsm-pp<ܗqVSeJlKsfj۫Ɋ9VOq,$W@l{mNV&CIa:KF~Q_kZ":%I ϊ;{$=H|CҒN~0vq,5"=`t~/g΄ƥ36]yYg3}RJE AUǢi, w%պ233%`Ӭ:T>f.2Zߐ_4A%H~c?σ]TaPNޣucI/6Vs \y!Ua^TPUh q[4zx[h[ %%Re8G FRZGa@b(Ge2%eVO $*5&V>`-\C>ZlN 3 NNA%!n@JJJZp]xWRݴv띔b%Q<0IAGhRBM79JIR_fmbpGx5Uts@mܥ4W|\nJ: ~-rE gE@i%uF x7AK'f774ږQBV8Z:"asۡF.lrQ*PS;6ѡ4L#A֧Pｄ Op@l׳zt@0 wJMtkXɫgx}6RQ,6z(@ ]T( IiJ^Vy@m Dmi-OL$QWRrv(mWrשj;o&%a\-~4:Tm55DZrsLN!zWž״ k*C(uf$Yl*^nI%K~AAe2ҬB Ѽ]C_ 5bow6Z03eKMVm<aQ9vW;ݘ!>yFڃXٶ5mj&aOdP&<~9#ͣ@*4-ɢ1gH߄܃xWƼw4<%12gn%0* ɯEѰ3 U-}I,ZZuԫU~Z¯!-̣%Wa--d"~pw$MgNrt`Nw#GQ,ѭA~BIl(KE JLT/ -yOzm0m1"$׷\|[LD"ڄX8ݜs1@mW8)hz竘?qS,`1esB%;Ӕs!j/W!b:DN˛EtK,D?|E{x$w!K)ijOuUc1tx-6"Άfgi:'y+ާ{tR-С~6yީD?+ٟoFw^AKYDrp )ܹ+<w}U&}6%+#x3${`}t#$U4#9"+Kvf878'h`(?gK{&U:Y/+biQ-Bdy}(XuHz[]I&Mx9o6ujGu)~sd,Vn akNa|md (PYp=;x*Tߛ9EbatM"Aha11?ve=Sۋ4qgX|Y)lnjDyrDR&~͝l܀v+`H:v<ݗ ӑsLa9'<gܟ``fW2/eɴsJ|,jw-HLQ>U,aMGiސ~hC=-t h5-taF h KF\,_dLaK~JA|䝇3J9+_* GӪ'`f$C$?dևȋDD4b7҂G>x7f>7Rb6xLVh1] %R c;OҪrSԲ{v%n /'fElgF8[SYkH&Qꃌ!rtɨ[$2rT7ޖac_J.VL AbYE?8~`9\jMpf}0,bY3@9|"h꾕ؽnRhRZVigAǼg/󒗴BȨI0$[;1jre_Ý3JѦ8@nR̈?e1RvXD)ˮZ$ׁ7qir[o` 㻻z3oѸd4tn)yW5-|thtGJ|H> 5bU<,{Jwl$K/;.þ7G?7dbD/&*jy!ηҖtQ~o""[)=^.iFvڸHh6LyS$(\r #Zckf~1\Xڮ(15ŴHL8ɶrY! ځlC"=#Z ԖĔ4MmcΛatd€WEu$T y϶]T A?g/p=6Hdb*Oے'X&ڨVʼnd=mRO]Aw^{ l/>||D(aWXƙO[wVҳ81։@d T7s? {,IЉH$J|m/@$IvHI26@qF-ީbE' y)j[}9isgփ@OG"h "Jln0kǜo3X ݑqs@fi OS94 TenT`Un3 x`p$LZU-L.c1AU3v>F&uKԃH k7٦[>ū@")o}d2:ôP -p[ "A~ݝ] b-@I*g+? IR^{y{0_Y %Zr>%?$d] zJu]J KnSƈ̔P]<fI}2b'h)gO+sM]0TDqf.+/&V;\=RVQX-uždn/F Fhd\AVs+ k+z67wq+ @# *b޽]c2e go8&+ަa>S]ՄJ7/@*~47j)bfs?IMc4K+[:?>`Oo^Zo :HGCdp7hCbzє&$mwGݖ[u\t|Y51O?B_tKJWvKGdiļ.Ej! RlA.ׅɺ̖BDտݶ:w`44߇.~cֿ4 JVq\?͐":V% GXPh-S>sy[bI }]1uuͩsܼ+;><[_3 {2tqG͹\^>H) OY>"zqFwR^S 1cde+Cf*&qf4S\gȚF^Y dGw+L`|M]kČeJFhzH+ޯC@wvobr-t7@L!c2 4} =/`q>6d?),a [nY##\.G6IG;z7yiwl>[9'ɴjG|?68L a*'? yiZ#Xΰy 6hp)ʜnQh"<Ȯٜ| /T큄$h=O1ǿarM^ƐtjTK'2sO#UW^'\$(vizmBIf/ys}_zAF0Q5pRɦőL;; ĚCW屈kjAgpvF44LF_;G&D"?8=8Am1R5hM w3q΀5d?Kx #4J7kxYm̊nSE^MDOY.5Rbb|M>1n{ch9L-[8koP_fW wy! 5~gJXk ZIAYl LJ'V'H4pPV}fa Oa n N\`xFj`G*,-Ù[18:v^{8X!r7&<>[:죫9UI}՜eN1l58 /)-3a)\#`]ٸ06z3vT.ԤW㉳B0@pqkdC9Mi.GΟaλ+C *KQ1&f0(MKحXԞj:${`rpt)ָo2Yv<º ƈ8PoH;cU> VƏ`ʹMy=毿X|)^>,Wˆ7_Ӎh4xAQAP_ !?2%R-\D``z ~>(>ՂzsX_-]– u 0_Ԑra ġlq2dAc':9eͥUgaa 'T/JliMYiADA" 3|(Ex[̶vmfÃ(vjbP[:zW^2Jt +W-'꘻Ep: Qt_[Ž{eߝl8ؽOBdb'Aip&Bgv=eo=;@8e^n"%^Mģ=KLtxߕdV~K)WN{gj݊H8~I%A ,G?4IܣP(ؙ$^?h[|~v"?kW*r>{gFD>99wp,im@NW˦b\lǩq7pY1~Kz&e_z:)E `޻?ŦDdFz2F !g-)ISVP'~t(# A89K%}(dp0vXlQ~Q/$}: ~*wd@ mQaq\(?çw̋|Ӊ!Ffhf12+*E׬)du;w8%?$BWя{d54"6rzgqsTpժlM_R2*Kb?O $]'hm){ɺ>#"=ހs2uODy}${tcnr# A2r3㺆z,v}ip#˥~To,,x)V[bM"e\2s53yFi?|!pU=x2gyrINv'_G.0!WHn<'>Pw*U"dU֪!< gM?Q"ONPs[qn} 1|t DRCU,Lךr^ 3V^ۓqU""shvݺ}]?4"ϱ7kث ?^d;게ui+3N/C2] ӰѺ /J`? jO=k[cNtm?! $JT]O*{q6z*Z ޿y'|sˤD^/ZoU\BխaW/q&POV?$ oC3&޼3rjVC|DJq* MruNO?A"2">ET 8-c^26cW@ּjLܠ1q䂶۪!FDe*loqt zy]h ?79&5X {I2k ELֵ%!~sM' J^_7BxCH#7bGڪwdnf(Vkx!nP]SNc$ )M#}9x%(ʹ{e! ~9'lC|G(.=TϭZkkzn56raOuECYjM8N^hts/$%mLUTo@iSU-ju.h_r1mwA:N5"5|$mɨCzu | #gz\cl,KkFnk@n9a1^%9i+$C8H Ⱥ?`&rHFV2}mXX[(`ߥ$UmHXMnQj͵0d :@W!S3k5cUkĻHp+AP[2@̝>S MXF{hS[jhMf\K3omc>G@Zy^n;/\R~)9 Jz?E%mEƇ@А=ӀCwF'BpBg :.A˾B?u.r#9$rh1`1kc~8Dj˄Y k̃ B/ye=4J JP-ڑHtv 5We4&{o, ;*ācdǰX<7l?SgORt apo E/!-LuXxM )3!tj¾+[^p;q>lV) ވo!ZU6 J{磘!6g{xծ6o4;#mbR L "㨫?%Ĝmp,Qb4"қK }f c$ `39~XH5O3ˇhQA) A+~Ʈs{h=!@NuЭƤ"FwOZEif e_W |c ? EE0}iR'*>K' ^EHPDcB¿-3l.mm Z$hR(g̨N \/`Wh(^+F=@IjR  īŁ}TS~zt-H7,ț濄fs{W1#lAsIxst\Ui+-,sI!t^H-. nfOd,6:hdҳ}GE;Ǵ01*^[|}~7`#C>%|h`p|Vb"rԘHm1 quyI,ʉx. H?m0>]X>H,р#L ]JHBڹk+㈳cU\3I ,NΟfrN R.8Ls6]<ߞqO0Q1=:i|@'blm;LO".dM ;(I!3_;K݋8S*xRqaMۊ=R֤4C4y>-|$TԖ8==\$#'Qd2'C}r.d0;20Y~X98>O@c+@BHc`:Z<[CsQtx<خOI_Յ4uwGIP5Gja\gQH"\"ˣ\t<ЎĂ .H]3ENjhE'ʃ/ۙ} ]X#βV $@yF͑ڞ!PgS4 DkuWqn WovGKYmAuQ6PRAK/;fe Zd3DAjlKO={R |&,Q4fvWOw^!Aڌ0yyM&ݪCϑ:g{cV]1|2Ӧƀ.F^`1,E덶lh~Sk*o*o,gd띗HEI>y2&CU5:PSGg({s|N[yfHR%ɡ,,;CU8Ykl0|勨ќG>Қ34{U:EDzP9'Bָu/=>]H:FZӜ</8/j@^jEkP(Yl:EMwAfvww;\//N!9Opl!]tyN3rlPD49wU=yKc0-p^y/ @ &62dlrv(gqթgJ4HrXpQDƑf[uS* [Hcu+[n*ڻ>A2~uN\iq׫)粰8~B^VVhq=:rtVpess&2'Lˮ?(8gT?TA M֊ ]4ݢ#Y2]o97>=vlĦK[Dw(}m)ĺYscUZ,g`)BTwzyg Oef(a2," /iMs7)RhY'v'T{fC$wv TIPq?/~2e;0? `' :NN Lؗr[%t(e_ =󎑄|g|۫i񙺫S ߼IBzjn,X}Zc5?;F/f6:pI=ߎ^~eѬEFF0}n;<<NwUKp̝ s'.!P/{A(EDVՍkwKڗknEw/i-ϽgTW'o~%q5eH ػi:y%rP_CF9]I2Z2>b/ [O/pnJ^. qEalAWieGu%2y?X?CߖfT/U >64l~?'I ݿnʖKO B7uF,S!FK q+D If".Ql +S (0r0ʛmRt+BkE8'F#c'!$$W\KC0#G1B cNw?f||`!A.{//EVQw bS0T0&Xwl,G|,xЇHlUdNU 6h\קCu|Q*wD+d`ф5{=q3l"k KicAD̑ y/(Z\ ,:%>AXx2>>s$90qiĺ՟ tzhEEbakj4 mZC9Q]|Bkۊ߳RAe4Ry\aWK4%TON̮ h\(MgJ1ht/'86ܲ"ǭ'hlT?qZeB8#6ӟ%MuUKQ-&8lh:c8;ܵniކ { vym Lƥy;_{P}[t*p@U"_{fM2 /^m ҀIn3ld;fZn0=ΡѴr& -'t#<fh>g/5 f?Q sрVc;qQbj6;jr7/#1J>~=c! #9r%.8b |i˵dӫr& eJ**NoѢ\J_e6FQ5hS YT y#U;ffՃAX4kԜ'pCD{z9XY&l ?RLAi)3ۛm; Jyj`%ߜPbu*m'"҈IG*ÙA?k` y]oc;lAEf K} zݵ ѳt4]67F mNg4-c?pWoZQ wR|Vd) Ǔ_`6"t?mon~/sN(K 73WT0݀E:E.d0}a3k?1dsA£e9׿ˎd{o\SCV38>Hό y-Hd͊O._ΣSAo5jѶ]rxhuPdLc-o(gF(P˔Z;|J.֒wԗ T>qSRXTC[EҍDF@C՘Nb~-Y 1 9EH`imvfMjnTKCUH+3vktaטǚ|oO6Go3, e®30gb=,0',:ZmЊ6@x,]P lgR賰7LHeQM;G/EC?̧oo ΜdDjhdv ÔYgah+4M^^o\pMTxdI7vP`Bk>p%PAÌ"Ni^ϙqaU 얆[u H e[ȭ΋+ֵx5 êGdPsgO=~(Pxoo~Mwbݥ'1p(C}fOa?&f:#G&Ns ҡ͏ #0Q.INQ* '5iUi-EAÿtPZ-1mL^Fh٣\#ڲsRCWbϞ6-qՐ\JI%y$P- _Wa/K1vvIF6X^[f[eS_ҵ3dѲe3yMD x4]_YlkXP5 fa=zPb4m.~`ySq` DtcZW-BRg-l[y XMW8*Z^PÖ`*5ۺZmv̷w&UPbu?tiĮ |vJUQ ..C'oPR!V$⻦Nfa(KLG!.Jj20"h*v`_W ԁ޲5_~4c7(4wZh 6dYz֋tgswl7jd8^A4Y.>dUegUEcR }~VOĵڕvH>/SoIWX/BhG?iJOB j^D.JGNhW'"5͜7cp@VϷBڌNk!O:Pڤ=\̻F3-D fN;l)NSLj" l,E8ΥP5dP١@+6Z }8BAaa:Z*U8FGMB8ݤ$ŠihͫGZy?,GxM?NR<˨%M8o!?T1X\ j^u:8‘MZdhaM}6d{^Zfb t[Y^FBl¿;s,,iiEm46E(9Z-_'^ۚNaNM%~pW"n2ψiYIRW=^K66.m[o\XSx!J-_ei]#V Vg۠s|tc6mП"hGMPû ܿ[ڋ}F!QB6+۹v5kvRA+BX+vtf1(ňB*6*ePkKGTbfgf011I'oVnS琥6)SL89:CA*rPkJioD(L:5qQ7φ:tgOg: ѾZ3ME畤⧽fV`وo\4K .y$|S 嬜׻ڢ_o=%1|pϷcT;|C?"2Q"p7 dcbd`8`8WU) O#y]q|} p a. R*F>6F@ExUf2D W23!^jOEyB8oJh1 -H UiVBJ )#PHEN~w.oFw {y}-O_<**"$NKuY9zQ>uQ|VX٧MaD=P?%'CJKGA3%7,L!9mDXSJV!|@,&ZMfGڳڤ;jJG=3Lr}VIxU|W4 O/목/SC̟#|;${S'o.+;W5TRDg\H/ J 2`W=|}UFpflj]fꫝ5a\EuOs5W:;6ȷ_Iߔ֮N*2xmd9.xV!u}gO_U$w0SaAS9τID4-n|LTZTS}rMTɃ0KwTY@Y'kÞA#? +BˣvVli35D9}'Tzs=4!!Ƙ6X^~nyڐ n3! VV4UT8ؗXi:yx/Zd|Tl.B3Z6vI <@wva/wH.2-""!{WⱵnxr(3˯+gXu>bDt2Ted:3c U~1DZ7]/2jǹ^p dWLֹ Ԃ֕[@:T}mqJ1%}++Nmq/P$]߯p2 H+صL73:4V,gml.sYzbAqЄkqut4ʻ4y1(_qYg?Vz!]V|NSSڔ; FZ:Bٴm,ߢet/Mi״߫g$hIN`oGPDOmNE|Ӓ@1FN4y>FK:)=O`ouGO.UkTf9TW3.OtQ\d|k_YOwweMv(כԶ[i_`fD*dgl}VjlR縡:5O<r*&uXyx>Z2[E󾚧w:e;&b;Q+VlIp 2l5| }&kE+lF &5cfH k.St=G5m<~.Vfcs4yY?&3ND/q_ -˚F?!֌OJngW,^٘u71FIMލм3wkZs6"R9DI40,杞# 4:+lJlLϡqWhGkU6kE]"v`C;ogX~/Pyv['>ËM*@zHז3ͷďCZcڱsuqM Ƭrڭz=s}]}7C/_]6ݑVu#unM!AGx>֫ɒ@5s 5/ؙSFNXL= gއ4;=JxjNڑn8a 3M3R{>K06%|*_O7`zsʰԝʠ6{qLĬ4uuʓLb&lut {XJ6^{k988CI{p Kކ%;v.{z~K*KU{ HA{w$6U|9}"oQ;+JzMZW |ii&{6j@|VeKNFrOӋWm9]3yL\f+ڤ'gX=sݬw;ד$OгbVIIk?m}x.,ÔtCl}-u'-/ _NL4GJ⊿6\YL-5}5 je 9%{4N$\pM0uz>f^߿KeeŲ0Z09ۮ-u_.Kz5H|"C,roYHM؝y27oD+>+cN9W% Bd/2,-ɷ%x]bvܗ 7~6Lh!֞{cߟ?l??<@{L:'lmR9Т d7h,YCHT h7 ouN{_%C(r./,.^YhlZ =~| d&;NI̹4NG]|xa& Uf$`Ih76$o>o4nN:kt֙sb籎v??d

`}c>t|bA'P/%t)!E iTP:g^APD aQP_aB  D:`HLo|5czd)6RW.2kQfm14uvڴ~3(dJm.^ .h-94C` %pLѓBhbuhqkOdC#b#FM mdǓ'&V3<-ptciwDF{sǺ #EI40SKkB,KĖf`9&r2>ygspu'e}`фPOE|hK}A^ b`Co x.-[ۣyo:nVaWU$~Rf@ls1dg?>̠{H]! CtTPVO-AyìF]6$<(2W$Ʌ. aKK Hj36omnQYmĩD *MTu,b :J^m۴Y3'Za/3pމ% ^ZQ|!I*#aR6d-F"eK/d sk:u|y9CpX\j3^y <0 N.-0 ..,e`莥;+t$^}9Nc`SEF"CAz$YTOB㻍S @*I(0 [nIƽ,}l DbI9k^o .A\sH3/C_ ic7RFޘ -\T;I{2>L 885,EZڅE Ɔjx!WcqAy!1l{$ #BD/q _Ē]LcHC3b >799?G{D'7OsO؄$ cFZh$.#`HHl&M)oCSLYӦ6ooo7 6>T} Y JoKT;6̵t6!N; y"&#؏>¸ 6P4鰗>eİ=aJeeR(H) O?=h,d[ؼhиE!:Az(~8HzbrBF <5~cpeiiv_^E~qhݢ%ffge Xiu[ş1PP %Ѕ,A]ӂ̳W(8qEEŹ ׍(,!} 9qgRVL8W?W"0,%lƬhgQ׎ُOZ>k>gp Ii}̨e쀐r`=<>i>_x'iS#cįʋE؁WII 'LNt[9[U$tbtFKKߗbtS!/da:'6uzx鿯Jb % zҼtfh`-/ㅬ c |X E=7!(5,#̐pWω ug@ءÖ>=~z!a"D(:MmYē K/-"K)D܈8;Y~(?{[r1jJ.@wژI`d)c i Tq&"¤9տ 3 ŕHpJcoGG&"IeR4Jӷp#F`(f nNmꊭKֳh1"荆AՁDmxB08n"mA"n;MfSE4O:f,GJRX 2`NrLP6;|13:P Q+*\ !nb$dsS(Mhm`gTda7A5JUHߗ#AI;= VټyhS>Fk2$g f!M_d:sp~<R24aeN(ZEޢMhgkn^R)I/b1,k$;h;XZ&J 3(!nPCo0w"889>r6 ^IoD Y_dd,NAlAc x71Z@_ F5F:5Jd{wDQN^,'Um6P- BU ?-lqO-ZT%Ŋp[Xۦ*=JjTo7y;ReY۽܏!ꄵ[7k1Xn*a1‚ "Z驢~JX|ϪADy%ZzֳcWu=~ 5YՐ"MAY a#nT$8eYM]V -븯@D@ o YhmE&MSĚ35].n} iWpX9t8>f->2t4nlR02ˈ6Ȅx. ޽q{\8NۅV8s,~~.`ɕ*%s?g)GZb,lNueU0.^5bw{K9mr]yg7g4PcBY@Vw|,a-j6MBa}=88Z+vnP78Hp^K{]טjB.YmA4R*bYVҊ/g "4]Խ{CY@F䳞~4US\/5$ܻX;@?7Ͽ2M$ *rv!RBo9-mD;;g~Nf7mkǁP~Qblb׿(74` qBCf]09/*!G,Aݝ9ҦP!wxIkE7mNF6j}h3ZVՖ)&@B1ZJ=g c{ Z1J$oT#Q .J@4: ]|U +*A s2m|X3Pו^<;fAYuyݽN7Q pָY,)ܫ,%Hv^z0]ެJ NKR'tIE "<hC \F?P1'ū+} O~` K}UH3v JBtB[a#T-IdҠm.dQ N@(D̀XUz[˟|=#z'z-;ZZ 7%OLp}CRj|m='"K$Qx*oηhgcʅίZO'U#KRȪ)P8JHO=RLvͫ-A% Wvrn(ٜ-;X|@%p. Ȇjk3*zBi"f /Fh w뇁  BItrvڇkpg4ɌOp+Q~031O[@YF|ʼ=b"'x_C5ɱ{7jY#WV*sJ7}QȽD}ƓEc٩:0oX)K [k9]l]&}X}9s br |I|/J0q zܩ* # :hCqU&JIXg3J뙷r#h! ^9g u(B1Cz&{e4}0q_bqUS{>ƊB 2 kD5RU ;GB rJcfi4 ò>ʆS4َNOˁݵdl!Xqd"2Iд:]JhRv@\ľ C 9Ir}@ښaup :ٹ6ד-fFy$tf(N LKCe3lKi e|R|K{چp'< 殱9v恻K+R4L\gJH; Ӹ 842`qG4O>g2!R#A펑thRqD@ƇR5 F͋fbŒkzXp)vr*kio]9eq@\C- 85bh+a!e1&.aY2f>7`<|؉3JUT9คl1S JZaHά󝡤_Koz9?~E< M}!iL΃䳬T!}eZG;]htoyI D:[Xzb:y1 c+=yEΘ $tWF8tk9oFU*!Qnl_XUq X5Z-27-b+ CGm{{{sۍGB^Wn/227MDƹdcaB' *}i } dngjX7awskױ@CUj(y}KK+qC߉Oq;B<~glp3n|P{0f"9(wkwp7Q 7mn0vfpV_&`1k3Fv}ϊ \O%Spn#HOTzv)lr!n>W3o2 jRtu-B)\2BeЪ')9qLJ׆BQ0#* hhhef -Ng o?Uġ8Kx Xly8{BJp) ?r^:˺]ϩrkQ)ɥ(Ʋe~w8o @H]ɪ`> 44қr~BF a6&!}㓦@ZLx7yЬPebfm2s辖,-^w.h/l^F9L߮pCM l`Jkd d.Dv)2pض3,^adf/RGG~mYS;F nX E#S-^c>:UgyzOQsZcv 1K~Ǎ,|Yrpp b~{y6 lYP9fxTvh޾U8qFwQ ^q!G[]Q XhtI lbwAײߡg>Ӥ#دFT.(8˲-J(+1ueUf} KVHRYVuʈM(|DMp(>gC{6)ub%4JqW<<䛀VY{51Z*qN70 ᇰkn E# b^$in sۋ Xӳ6J"7%"}u8jx%._K7G7yg-NiaU@ А;@+ƴ{8myV*vBǷ iI-:"y寋 wdTH*ϣcKt iյuD]kŀ *%;dD"rΎ c@a]رI:4"y'!= ' N65hsj5@lT5Ny X̀lG=gBG* 15PH;B L:0$4>s[=eB,HĪYKYn-p`$>c*):A&NE[0N`녹GM|>>SPQEW ^~mQB++=D.'Uɮ*$#Z1ZY*""#I)k%s֣}x[۩TzwOA-I4ڣB1 %[6}^D>2H/tQL5H sa!\{%`XBUn%g<yDOGǢ@)૯6<(Qb.4tG3^n# DBMdlCHϐnHSoS@1^g ,!sZA = , B(SUrQLBX{Oj ]nړ ,K!%* H2b<ɔ H_Bqor dWU ј> ̮wP op.J! f/MTg_b+x\ְJgI֎NzKnLW;]E B AOgZ ᦍ+t3>!rIw 7 \+Ɍ*(4WBM(&|XѺ5Xva7r=/pm%= ;o|[/.7Z@W]T?X;77~|=(h>e7xc (3@m͜ .{\, 4E=At|fKE`D.)ߜIU7uY?f4&vBTʵypn)0:yf8BغV0ܓ/x\vt#~-0[}O`ˎR4)taPy+ksGyOD<9"鰃`\)ga+FԖyUf"t_^=lq$%,lbSU^7fut_p7M=>v fU| )e$`bBBφjd}j3v^Pv;\TrK+7{MSRoN ]DkO,}qn}X[G :e'8V9#NrPmhlɝ4-|-nwqK?@lET!wX'j-pZ`x -oa8TՃ>#8`,l_UñXj.OX"rN> j#&qנ"7}rp;IlJL4Vv ?ku$虷VeO!ЭSE #'R?!qQTw%!oH]#Q?ͭ4F 0GPWA RP0"]10Vvǰ5}ꥊqb;OGy2N^؏{w9^]^Xfd"Yͥ,HےOhx;dKZPdE2? r5ه.B?7Y$}'9~c Ko{T.dMDN֕ϻBP+^ҊSXV&QL+}Hgo_hpc;$q8ӵ3۔v{m`WV\dKs7뮢n$9;6en͐c:2J?6#ΖH$ɘ$_1߸z +hbf6>`{ߧ,*t/8 Ǿt@`%TP|&Ge ?M{p ,葼bY8fŶ5g2'D,P~&5CHԯP \ˇW#Kn:V!r{bY !!v;v#UA*C(VXxQ{u5cvt]u\{KAWoO^R[s{IrB1GVOwKbG7M:w?|CvQ&oplw(Knlop{wȼ|h'Ľ .gwV]p7!h>!܃d \Ka|=r/bEeCs}õ%DumO+ĂyHZ\ >1nx_"D"$hr8<+8Tޓt,wO9q 1.qz'5,X 9+Y{4ˡwl^ ;*'Ht};a1-'h$[LL$U.j[ q U^6`I?9$w\IRB])Ԙ[Fmˆ׃upɬQ;Q}, +Ff/ 8qBzu1.xv3iΰeQ;W^3v!p`ao q} 0U+*=/@*RBbC>A9lD/6.qLf܅"m2Ջ@Su;T=hGS+!Y3JwH>F /Z ̛KAv5,q؄\}'ӌ\*ujJtYԿbwU%tݕ (2e/mA<%@Oޑn| Zj*s<@@\u~R=+NBv\jӗĦvv jrR$ɴ52u5wl#0l]?ŇiJ?-7oe9w|랲wGhlf6,;"]HSL[LY7 LثB/Qݦ1ߠ.MfB UeIft^<118N N[:π(.xݝOPr.rUגzvIX&!W;l&_xV~G |9Wppێw@u/; G:U8f!dqEnX5I8ּ[|Zpf`ou*RzYNV-[*nAPgTV$j6prlA9Vne7 w>R*,UYLp])˓u _X]lV첓hkO59.xS六|,r7f0~EFYf@g=E-w&օpmOU 耜y'!JPP22_ǺXzaA7Q"W|U~[`ڗͤ <-\} z^3ޕ&,Q C0o,Q bDʒCݹoQP_ ]<5pf&6EJ Pl4yTXv%G5DX-'M4qj ?6~JXFsa~q*%wЮa_WY6-BoS8"S3Eir-"RHЯOFM ֶE1(Ƒ'I]Y%a95v+rŞ1_0'8%Y-t uaiFXP+ק(fk~% Kw#\OY0;mA~ek@j%V:g!n&f/}݀6}n390$Z/;W.`m?#KSbHBN"xVDm ĭ [\qVԒq[ ;*R暍b}`k`ZaEY7)IFz bǐZd֏㭖B `E R{YbM#$Kqcv~Cź<w(1K~J0rUΓźVҘS \:M6eiN LPŵ %b:ABnqqRKsc`])B..S0<΀bHfͯBa*Yha8T!wHcA , H1bC,C?]4M};Ѣjɭ(V[gNCqMYY^z(]ɦf1׶I/jb8ۿ@=  _T W QE%wR9 MR 8QA^WoR\ε LyÇ v5-(]c .V)GHj1[!^N: Cʩʓ@"I"ϗLT&m6hę 8(x'\%[WOvL<2\.֠'aXC~L8O ꢎmo("JOt:RuG8nޮ\}x Dc2KܤE!V+\,Ѩ B 2lH#x 4(hܵev*z"v׀EfՅ%l`FhźP%wDnRXiϯW@83a}SL9w'J9=0ROFjEnfG,,Xp)P#t畣# qF]ע;hƀl =”4 gC ƹI(؇c_EŃ{0R&@xySN DӣyuKb9٤K" CN˾w@{C8h~< GVީ?şK.#'qea(e)xq9i7Ea//%R%:&{9xהuxG4ޙ"jOtAq0z3Z [˱3苣iM^-X1= 9lbpK{[3bç' }V| ޒ9lvBF ޻xxz'wY6wtww9l,/:'.j" !#*"a?&Y1_n^}|gf{%YG8!,Uz+P7:`w;.&㔉wm:kX;gxJΣg= =,pF<~R 4FRHV굈Y7C@1Fq̐EUDvnjDlf[5w/F1Ɔe%Xl4V)x.z7CI#Bj\CΤePp 2RI`[p֒bILpKE0ol{/6`|ƪ;:x`@z[Vr'4nUq.0Co;G$Q*T4=Jdi|ܷ~k)ٗ:yKN<} B:w\Rx`ʾDW"1'K  {g2Vq |IQ8qf>u}\8yڳ?!g.N!9NLᥬ %N)~H4yT>8w&AsIb[&r~[m1fUEz[~(֊&ΆRs8;}Z^{ K6M* `4|iMbm图=d9{$Q,}jZ l`6ˌ#jYűMr]Ѵe698|-3x`Ϥ<(o&B,uǤn#M'\S\MR``y>HjqrΉ9Kl3rkɮqȉիCT͕XYּgCVO eR/8΃as̿ǞP>xiri{O%F2(柵a qNCNV9I0FQ-$x.sL> jv]'S"_R~Ű/Q"4q^g|7lFTi`Р}+ \UDTBa;N^؀'uuݖ|} sn%ARuS<`ܝ͹? @f-" } b5ư-ETKou„Ö)͊Hu>Rܭ oՓN> 7Ao| b`Ϻ )`Fi83+D4UջM- 8@'toA˚ 8H7.V6A6j^DUzAB繫#TK k/y#-{t:(քִXӨ=sU4~9H^fe-3^.^z$L˻!YK}n V0Jok$2_" gvt<vW NeBp̌b-!ڊեH9_]Tꁠĝ!.obwv7Cz/EP:lДZ*$e#=ec!Crsl{;]6+TpeW?AJ"O}c\@xGY h#Ӵ{*^YV-}J Q{YD:) ?OVuchaU:`SH\=u2uPJYwpaۂCxL% -oF)T-Agv&m6JRl4ry3)3 PAٞZ8æ lf aI%/bse`:sՙ:?f; S,sOu2%_$,[{pwebO18 )Sx_~>q]tY$?1/=DHѣG?^"ڵ<8S;^Р,bN ğY h i؎*0W"-`qpK73vTz*؅BUٓӫ';Y<ոVKԻ.#y*HXo]=^{<8 iS%b lD]DKVP} U@llW*s_+iqQn,@譢,3.fjϩ8mۙ.ofA@gv;껊)@ڃaAY͈l9DP@P^@+h 6=Ǿ m2mWmӒr K1=Dp'RzG@)r!F:ȗ_scÝlr&?|< %bM<0R-fc F]Q@rRuDt+{+3 C`&|vs~e3Gپ]@_v.Nnv@<|&`I A/Eacf]6O0mA&&/yHdk4 tז 3?l+ъvx^VA<#ݐe2f湽1qLQ1Q#/ x-5KB>f%'*`b=3 N? ӥ4Ȉ&<lBex]<2@R+#`Nzkb$oe zQX:[l ӎRD]?vTP? cO\^}U*p?fN٤>We-Z:)Gb# ^jilIhb+<~&<#Ͽ$Ο䩕$Xz;ks? s}(܋u&d%`@CC$GU*CVa1}rԝ^ EKڻ\ #{NfB'$pgA>>ޏy1byjA)cȗT%05\cXcR5[|IpƜ|TJCb{"ixF3>5TtQ,$n,@s:\{chTjL9N a86f#g7Jt߃9a`ʎTup 73$Z{<}/9yх.@FGH<2$Z>!3Rkz]}R?R#@SLG 3FHgϕZƓ W s`w4&ċ,DYEJ VMrz AЖ0PpD~$|ꋠGbB%jƖhh^;nh \푵`}%njAPsqCcDu?Z$zBf6֕n6 q`!:zsibWģf6bPI*BwneI7Ň$^+YI=c)9p1Hٍ0&'ӹ@zFxZaJRE B$=DڞV.V<ۖ冾py|Ȁf1{hPVߨjK^**R$mCBg졸~AuJYD ^ʇ8$;R~`cdVӿVϰJ?l.>sn{ jq)DBn(H Pl$9['QqM礈x$Z0I@rz91wAWEe~ܖ^5+MR/%A QEt_Btg,2WzBVqOHVEy[ArPU/{gʲM]mX7vJ'ࣴ:!%LGx]l@cR ]Ÿ7:+^=J>®CTJ0r :h{e x U>_?-gVuJɮ y[{{ 9g8nwmHbG*DM0%y82 {Jb .޳mO6'pqSMՉQdzZE'PFUmm-h]q칤Z'L|=uDfP7ϿXJz-nvᰵE| »fG1/A2Z,[msĤ:k\p"ERxF%tLq-?rm''G`mPamRyJ}s]]Zь< xU(1ezDzYd;T||iO"dz 3I7a" 7u gZ~Z;,# hsOCOn\|v#JCc̋I}po~kf!Fc }85 /?ǃ\0 >l|"3*`rjoz(F/ia"B%||=ȸ\nr(&%"UQPRs)^$-@,,^XzָEݫPο8܀ޏ:@!X(JD/u=:2V כ3LEIkE=2FWj@OJ5lwW.\TѹH*(~3AH V$_Šc3婪s˝Gh;+A鹩25B;j8@rUE6Nvz+v6zG{Q-^n{ PFEC<-Nև+5s#DXZV~AV>"PE'm,r.PT^9J(b2%ܵCkKh͞P\󼝒ٻm!ʰI3pNz?# 13]G!}&ڮ n1\7/:pP0"]P"(1OĽ oTrϿ[; QF&Qc %Њ ͗)69%%ED3 D34=-j{NmጅLxFGTiyI1>{M<Ϥ'J~)"x3w5Q> ݬ۰oM= /%4sֳ/-!8WH,8ĥ\<N ǥ &x)Mm!XDu LT=7tjZC1* vA&gzE߇nVEn~ˣL 6=I/SBczA% dgg\ Ko1\]ձ*R2 0cұyۖ֩/@闏2'bMԴn9ލ#;*﬚~2kYaǼ$KW͊N~hɉ#=־TX) !3/`,BR{k@T8Ca4S *N6hu51Z՝.8BݚJ,~B uH&]Qea1'ߔk:utZћkL͔{J881#_ s7gU)yEw&glD{" Z ŀ_!, ߬^OϹd鑓O] a)YxI-d `imatsB.־i9;µQnlxٓKynMpEfMXC/+۔W⼘cf D2`1c&%x FčE~ݠG9O/4|)>r^x$ωJ-V81{F۞ U1 K49uKϦB^%J !ױ:cuӝm *v)87wkgh&~+6hY3al9LRcK_wD ^إ&8 ۯ =͜PG7Rn Rdˆ+z)!2O.#$ab8^Z(B fJ> 547J],p!?~Zh}뀙# %™Nk نa= YaNy\`@~) us|ƟiAĺReEuPٺƀ r|w[CYlUC.#$R w]O?)}-FcDxM8uOcҀSK`rH X34ރ\%0Ru0i3mgҝ./޺WnM=y,CZyp,x 57V%J^ow܂[ WF_:9;}f3;2vf=/b; B9e j&TP)=ϓIMn0o:lR#U"Ͼc.͕y) @Rk烋8%`51 @}ScS =Rd.)Pz)I)+T4'-7XN|6spQ}+QXCʋ' vY۝-ΕɢYs4B3`17%_b{NΘ4I9OZ9MJȪz>bq{/E$VWtת]3dW]sՙ*ĆIr 0$Q~j5?`d3cX6ķ!curByn/[Ʌ}s%s$^EF cqJXqcWtu:CN4.X沝13fM˿c?pJeg][|Ű{J .T42T}0bKr!Ož]<݄ @4,L DSҲraZ/^Ư1 Qj9&m-唿ꗄ2twVOt\vaT'-f<%a-4I`>ĚQD;'Hb5FK>xl9if ȕoe3>&{Mq?ehLB/tHb$U&?Xc7&2x0t~`⊦MRYGc#?BinDDiRx$k|hn6c9֧]Q(x-K1#A.޹a0|BAZHblE->hWo2ݗ/׾MDJZ;/<@}a0%xޥSH53Fj^$ڮg9?Z%=Hq6bs) (5+.t^}gbdAD< 7lŽVJH9,k7Tw)w<]8jȴ`sٸYq6S@%(0|uqGcε>B<)=O#ט}s`|&:ʤx~:>FIbee!t:M?ԾOc[tƯALM7j'[X_ׇuw l4Hbh}oCO*, 0$I_ir˜B %OI|LHOyEU9/g491 cڦɄ+I]$oZ zv>OdKrgKf_QDTEx!Q.yO1>F}a[ۄ9}?b"h:#6r;=Ȓ"IdqP}w*dmIf"/̰\{\FN²D;?FH!k%\Tɒ/UT9Ep|+?? wtдW@0UU<.*;h@et0th<3\K_ӄUz5AѼ\2;)/u|o6A e(:[jP8؆8cfdrƮBv6qK ։Y@v |!rh3OKRj P&]k·OF$"J)3h˶%bL+"!&%R`D*q}QaL_\Ey(ǠY-`p5(-f|€^*V! wԲI]m->wfrScFD*eI<׽3<~-kT &f/](I' { Jx8j(7̪/U%~ki4wr\%d 0 :qNIq?CN}b:d0 ,dOk˞ᝡf+Vr3Kg` {Utn`Z/9X? UJ!8Dɇ͜vfp]@ӝ7mR `/ MKq"PMtx%T#)+Ty9܁q8\ p fdaZ)vbyu=w%E";D)CťшI>q]z(ZOhZ &UW S_$1/W77#O[IW{_`.&0/-^#K`"J 9(ή;ez Ӽ @{/l6t>q_R)ǯC&~ +ҔLLч$F_*;/ AqJq9jҢL}9t ]ڂ,9ȳ AZEy)ҫ >ƙo[FVrm}``C|4^eedpֶ:UK5x6^G'NZ֟^V݄b͍?JЉrPO555]TX9CM(Ui>\;Cx[N8̼M  9}MaW>#VBuCסqV*iNhn[`acRk xojqۉ\a^ G_KoG68׼+@M4Ak#XJ$:b,F~:krb76tOFX:ZoF/;>[gyǮ&X2JA@; #4B ش:ai7 7-{zϪ䥧֎56OR)Zӟ5'kdR68~`6{.Tj7~+IJL2m|jt[<.pх|C9zG]vS &~X<^؛&tr Ϳn3EũM/W^FZON-[u1RLr* f2-H ,)a f}*2}6JphyITe": Ap̀(…qeN)ۓ,Mx^DWW poll-0~6iPf lyBޓ =<[ҷVz$EqЧ@.Y Ѓ+e9-' J֭U;8(Pɺa9.:v{iU\.0A|WG5G8ݑѕp>6oylCKúڵdb2ڪf-i/Dff2C$!}8PM 9E C>wHȀ:0bzO:XT]/{ԉ&sDd[ǃ WJTWim2c|>9/2% 2ך,dЯ#Q+|1W %.[wdu_ ߌ1dxK> lxe)L2P:q(Rwu[ݸ{6H $:)X$ЌݟYr5& WX Uo$[)sl= &7;=)pjh!E/" M}Q lYIkw'1yYU$Si_3[^!lXq*,:.SrGyϣ Or[By)q58Ko|4i .Z%fD0[XH ~v3ۃK`AcXm++'^3yp "0~ӧZD 5*SNf6 jC66WD\xĖ7`Yb8 6HSz,-FC7e !&37SKL.ObզAcޯ*S蚐~yTpV0iK cv 1~TXNY0]~J{9uquO炦KsgHpyWLd5.Qʐ43JpH~}O-!211IyBԓoo'eu X6()rBE Ref:'1N-%n+UmzJg3Ϋ7yM+EoȋU4=ιyF362'j LsF'MnA8udAJ$m˚ر=[8/ EJ09Ԙ ֤~~5jq m7}F@_MF*T]zoJw (ּ]^ /mb&CǻQOY:amYP48 <,mß4(,(zxɖ)@izlwUIۥڥc.H[<#jO&9"+݇?455萭1^JPNGsYǻ]Q׽5GoHǑ;VXhLsey5\5&,x> l." :J*\ᢁTpE-F7Ӡ8_#x[S`C+٩Нl]uC~e?oK8j٪ܑ{aoXAT'3 # n b~B+\R tZh$ Ҡ{?HJk ePr]spIEgYo>[&H|'')WqN|BH|: [Zq 1)?V ,~ͼ'ICE>_A{hδf8=\\!E0txP_6<钷ZZԞ&2i[=iB;0J`? PDI5YAv:YP\Gb93ot`\0 {( ޷&}7Ͼӑry5ZY3cۣMnf?r *elq5s!emR:uKgci:Bp!1YƅjpM~Li^rX@;T?Ī_N|/&l[\T,l ꫻Ff/,nJ}ѝw}~$&T2A!OilۗvZY+?[-7yM<kZUj ӐqϚs, IKg-@~} +R]չ6μg^M@V4p%9.sɽP~C|/[B>CQLg$x{ G^4z*%#"I )s-^f):ͳV P d1z+׹v%ě86 B_Ŋh.kw^S̳OdYX=/Gk䖲,_nH!<%<3 }F}eQ a? ڽ*>lfYdx,YI/-snATX-SWU̷B'mZEߞ7o6O(cT2M6S^&-F ߓ8Td ~wlEB,IJ,b9 *X%ujJ̒ ,΍Tѐ+/H1%P-@lp=䃇1# UFG1OzT(@Vd8/eHi=aQ8cq+~gk?9LFcزa{Cܺ~_XVW89Լ#'9`qO0<Ƨ0JzXb-' 1G6؝ǃpQq$xa4)СAn50w˴:EsziP92*BSȞ˻A|P`=eZe$_$A7 {K>ޥ)fRev_:Je6DmO\U6*rņ:5Hm鹻V ѡVswIŃ򙁛]:Q%Dk*HUg̓7dhwFu/"DbJ6=qe逦U$H{k+)"֑w. X`+Pt#a`$P|07ZgLNJd7P0NqL9x4Bմ nSC(zAl J ǯDJP$EJ SdґRˏnS *zz0NrqDuDkAŋWLz7l)W5^TD pzڙ)q0ɋ'LdK·z;y0QIT'\NZe0dmאt"6F5SmQ&:ʶZxf1ԑ!O#6:U#B|,زFjhiIb".EN<|om24^(Wvn5 ^4Fh9:3i͹eId@ǿ  9 E2κhw 8;jLXga)*BH=|gn A x ?(p@dfgV,#!%YdK't+%+],C=RcK\SP-X!;]Opy2Y/?g'!%5QWGmTS $䅗<Ę*mN T}_@3V 4)x hs H^Gp Xi(T#Pr3Ct󌤤3B6/uޭ4$5ܚPJ;=LG^àO0)#B+ #_ɒw |Nr҂sQmi|9PJ93ZY!^Q#"%% . :4]-_RS쾔n&>/QrAEQn^1q&44Rrzi:O%F~^ټ[nj5ыB|:)XDwdէ,D2~U߿zFu-D8? ԋdo=6T 89w;)Qƿs~ګX&vzpYbR]U&#i?BlEsՙ'q}N/yn=wx,Ώ c"-XqOXEC%ΥVJIL1P l(N\Ͳ'brbB5g yl#vkCY ȗN9>c* (Vf;z0wàF~#8W5a!꩐ : ޯ)1ϋ8.H6TWg gX᥍>nK;% !}So 51ʗE)E*G_R?%ß|+:Fi2/;  T+i^3F fOh7)g#XeeEYW'xvt fkBl]e_ߝOGu)h䜿5w3FM]I  p el:k ǔM*$-) _LAr~ݴqϯ(Vqzo|'u7Hc2 t B':q0__uD7qz̽/ꓹ2}3.㵑FYh?Lbv˂%c,y<#øLoА4\ *TrL! TjSiJNDw l^HI{(׶晌4$ AJ<( YLˇrmFd㹦tȗ',UuJ6U35)!YqvNȚ1cY KIMK$J #W1y=?Oż@-jB1AƸ%tЫ( +TE#Q70/Ӏ_  Sry}O W=vFq! /*uo%;C`K9]? ѼVkkUc o)&DXrpu"1WU<W:"_ƒ(@9&"<<\M,]_<;#}čAfk Z6+^N"mp_3p T*[ Waalڸrrc˼DzgvSU%,eas=/8ih@3 &hN8aag@(ξ6}`4}}h:1}wK+`8e=Ae5,|L}jedt7^N/*MfD?LL¸:3x<Gk )q``=gnw87(yww/ͦ7V^RNbt UdK (:n7QA'&*JylJf_Y]$ВΑYz'9xv!XڨΌ(AxEQ'cDJMaoPwNOZ+\HL6jyL @} JA99-8CtFOiI캝$zv^ D߯)sn v 鎩 6e6NkiIlMcI ~D"To 2ga_m ֟v;0}BVW3G>$'TfnM*0a-NPZ@+I=-]x<*+GR5K=#yo;;KO8ktZ`R]>A\\cimGFxrL+觮Oq:ftŕZ^FSi5i^ƌK{0/ `W*z/%1}(/0gv褔/km}qj,箃Jz)XИ !+o-R)#jrZIiiS\~+WE$Y7L8H$;= ]}`Fflæ-RR98w-2)9 ,7T@m=p,QbAxuDQfW^~os3qu%7ɍZŜOe=Bȏ`0Gwz }cutEqmO,h5zڼlY.MɩdC7&wٺ-l`_Ѽk6|titjum{XN#4NjhW&(g!p#) R9x=ݎP[(*&CbRA^)d< abB]MJMK%X6)Q5_̉ FYNd}˚I_Js^} {wY__''Cj?{[[^^.(汯(_ B+͙:8LR!c RiûH73ots3-#:؏`0Tpb 7S:娫H˅ti]1%zi) oi$['ӷWFYv3]壊z'^'oY-~tM\ EoWĵl bcLuWďLQIEQHIf&(Z$I+My0v0cv+}PvuMIAOXԨFg?`^f<'eyO+<ǡv))iI|=ӟ0k@y|lL4۠Ci4s(.s\DS/.c=3FAj0ݳrPL픍BTba5K7rۋ_2[FG a ⩊z:/pWjMmKO[ tKJN#Lb3/PwFz^q\~> 3ᑔZWV8 r<͵]Cl:|,:Q3/pH-:C}CT '\5f۝`4(o*4#XO[+4iG%N3nPrnj zZYl@NMw?BƹSͲ8ը4_W%w3lyc#s'ny1:ke4Bl!m㽊N^!R2 D|8J+(:O{.\w-=.d50JWG/;5#0RW]Z1xAݛ`#b ʼnTU]23(; c_fR{W׭x~&QuE_C>F4up s~#L`2c%nl9d1Pnޠ0)<$\(E2bGsw~A`| 8|:n`3'p&XjLFTMxQ-K=3\ 0.XjQx_${ݶ H޲>xz|ȵvs_nE s\s, hU8׾{MB ^2 }K^,~g*S.<%}WqN "7nt<2r\54S^s,XaV1giTbq?RIwKdiw]CQlRiOD.) [E{|$t[v˯HyMCXSFyv{38T+[@x" MX\ +]9-ƊSc#ɉ@BZLMIH%$2ڴ&\`YA)b|h%1/ - U_YgJע>Vҋo:_D6bd2Ş<=NWx=7f&yU 4@: @x#PZ-vA 6 O (0(Llw6лd ,`.s~{lm,Slӱ6JO:' M[#[11Dtvٴ{eCstdD35;v^O!3#:̊#~={ϐv<SS5xd9Q6 4tGhN/_8[m`ٺQ#PQэ$psr4:<1ZbiSђD{{ţsOWo$ePWqdU|wB(Lq2t6 0bTO"Y%h{!EwE6]@T+#a&LO6{7|?{aVFZ@i2=0>D4YkSe%&{V}9E6학<Ӎ}۪uHKuHb&fZZbXWf\a[yOF9kI¢\c@_4=rM =mWAJžQ-d}i'C ?fZД4P"J|>wHXB|&ZFУ)izh1O+L4I1ǡQ(rpjkONΟ PgA4Yrp9/4iUچ}xg& F<&UW¤6OQBE9AKU[UC}CS)uCto Oݰ?D~2<57B, ۑu"aE[b,3Ѥ֕Z^JfRSZhnq 2-##>zL 2ڳRl>i,dUdG\}=uj2|<|Vٲ09/,= 4h'!Ve&1sUezlWSht0+7< ]"vZkխ>\~p>\qy]=5sRaTѭ}B'O ʌkl53cFge@YBO|$$bx&Wpn_h|,coNr.-7z*X\YSo 6KYx?bE]'=KRͶ:wii| I[ckݘZ:( upL-F*y MrLλF4],J5'*6:l*qat璜Ts  9k8ApsIspuf[؍Sz֣gӝ#t2a&O jېv . dL!فgw҅Rg;,BJ{0P}v @:mfs6AdAiǛN GB%/{*g*G[rNuFku\'*dpvvc/R.bc\0 2CpڱT%-QhGρ?LmÓa3gw ٗtXkΒ̪Hq}tĄZqU;zD_Lqk'4J]VIz9s*B?ľY:Wԇt՛LS!z Sc)Q ËU27Dus_%"ݧ[Ox_bFQE[ cڪqs Wjk]":v ka63:N枔etm\,&PNY}j<ΎqP '3ŒCs5UK7t/u8w7iwW71ZqYYn}OO0evƓscm9Oڇώ.V>'ێ(ih Λ1O7[LKPa OG2_-"O6 A 7ψ}&O}<ڡF >uJN#H `2bBN8G*ӖfsdneN;mVr> hvЊ>"7wf"=Hd8J%r}(ҧ\ `c'j4ifj +S^܈X,mQwC2ڔ5TTmgsĠki:q7r ɘP=wShOɰHͣP(,QP4ܙ>O'9[N8h Y-8^]ݟ~w98~?=^dJ=澨{gñ`X-ՆKODT7σ,@_Xnx*j. Ԓ/k4$̣? *qL_3tb1jK,!y_/^3-Nq޹S(᰻Z5[i:=jMK&?`;8u[Qi wnr:8o@{|*bpXd=3s hK+TP>*Qs`]؈♜Wn* ~ۆnQglVc-{l^_ؓ}_!h60@-Y.HA W,P&xRI^ZuT}Tsz'o<Ϝo:w:d\:/U~~'QMOటp xlPtĥ;a_`*XS Lh ր31H eHbA`g &,Z$MHZu";,ĉ-p $-,))JbЪZ )JJiP TD"wdDwuｷ'Zk{ζ4' (+0Vꗧn՝ϑ93Ġ'ch'2Į L'B}L컀Y-dz 7\Sߓ>z~_k폡 3 p[[V0 H MB؂RBn h+G#BB@%!n!opjL¢0*`[^+[V 7 j\{d d*[[RK(ѵo]}7*xU80*!i /*T(|!pq o/kkzV h&0S0TV h# r˪$ f%BX)`jAOBv^,al lX*[ U 0|A0ЄPF : ^*XKp!\BH8*0UAW݂…H0T!amWi!9 y*e7*!K- QP:^ H ^/ X+Wܫ3(T]  ozvJxR!B\T +[V`3^%@V@0v>@IQlҳ*pT _!:.>U:I^[b -t|MXiR/J?4Jϻ6vQdAq^^ڡȳMKb:%HּҷyWJ/RgB.~Qxy;=/Ƚce%Yx/?=֏H_ =U>>F`*_dUf/?ڂ:@b_{^URG"x7̚/k7Lq T~ЃZRB? =HL:V4x.ìM]G|!]rn:YK\MW/tpuIf]?`{Pګu. ˿nWGd׽:۵D(.{a-]~7o$w/ kPj;UXs/tnV6nr`xj);\|{{:[)gPWA~;#Jv% 9>hɐSwj{ P<^~ȇ8 Z[;Pv.P 꺝'&^#UwAP[J|*4!3M>bL7Y'Z>T7(nNMBu0lD 1L7lbYiWo=k$1RK۬W ڃF>-b-N#g7 gn|Ip%R8 Fble[ TeX{e^nIGeM?tdU,ŵmSx!_m%+'/^ -{O`[_vηHy[ ]@#1sKyK:?s8{iAnKkj_UkBXa]/G1R׀ߤ.8{L zܭIrK y;9x[ɱolg-bT}qFb[]OljCÅc7n9}zWgR[֖UnrZblj뺧8R͘ ˮ5wUo/f[Drn$*%)RF'϶ ~mR#9 >?._Ho]0.y\hvyc @Pz\&=WV)sS/HX<3?փs^IBM}zh"=eɿMO-J$vsaZ܋omMix=WwvȾ,nrZ>2:/vG~mY_sn+qFkA$tkͮ7{}ZDִd~q7iӇOv!WC9|q#/EbYomR=(oZ\[Oy9)׹?^zƎ2 ?KddAY%@_$ 7;Dqq(i2mLw2Gֳl Vzċpٿvۥ"H.I3{֕Wѵݫ+,{orXqZ_op!6TU{773MpW8/>aA+xjskIML~KJU{|8icI\@ROb$͖]v@Yn~VҥU8C('ͻnaqS|ojJt/^Wk* LExp§<̩EA{{{/4`J/f?3Lԟj7SdI4͜'uY0KG8c[O<SzC*ƴ< fF|Y~?m3%oSP&AV(]3ZwH=O&eHQ׮?z$y,wճT O=3Ҙb[:/=O&Ҷ u8'5Ni~2 >N/祽=9䤵n0mmdϱjJ[p+/e81 z{oj=!'[zjo>/Mc%Ҵ*̥rB_URHŪD\7{IyR.>1g<=22M\̩rJ5EcW}2:Q =΅lZ]^ͼ̼ Vڟq >q*y׽V2ّK1=Px35 )_E5o^]b//~bjMv)Ab -t.v BŜŕH*:Ir/HYO}:ט wgk 7g:+?_*wb*$PW?aKu0Kb]۱W<1BC^=}=d"^\Rʌ3IݮV}Xt3^42΍`%sҀH BƉ%Zs)C[`7-чˈbb6{げUpN|8y-%➃e~ \gy<7`|հ+g)I\[#U" "I`W^+V\ w~([S"|$ K{nƎ j] c\@zUOOuZO&aO2 =_I0Fߕ_/~O‹O[kz$Iorit.])yӉ}L'/0S Uq4e?[_GA?=I7n@zl&İǟqQI/D7ؕjx]Go_owXK'cK<io)ʤ o}Pr+,v{!M ^90jz@RO=kT*qr cT]U{ie=Jwɇ%K/_%̚ ka/PI=k@ڜĸ'odN] 5,q.$ id6a }c4mƅt|]hklb5vp ڙS|0[߼S<Ɍs}N}4d Zt9|`Ф霰%AGCM!\MDgKS6Oe5B"CgQBf [$Z_zO0 쟤j5yWo/ : #ԃGXɱ  |3D<#*LN-+7 a_4h<Sm;ʖe8"- TS m8dFG&NT @NE JQi mK+ o4m$Dj jҮ+TiE6` ⱔuGcoܸ\y6DeX#g?U0 GG mL Q+ Y  nbq7`ғ[SL鈴ѱHS`EfQ/<,W+YE&NfK9Gp c; ALҨvmYZ>#jlvunv+~͙,Uhd( D*6[%A"}veHarҌ7w8wy=x,J1|Sm" S ;94O$ƩVI!׈seZF 0 O_n>&IVHZe!ĭ> |SZUG[k߄,ز?-p8d&6Z -P:cLR9&%\̑> Shćn!9Q9C{ A9nb]mؔ&kC+FMRFG52Y) b #7T6jRo *b܅L"Rmy r%V&J>3a눷pFI$lL]"uJZ4Ԍ"xM^Gn>ԔGۃ!?Eg'm7NOg Ԩ2 vІuG?;`|,p]<+٣9>Wv2W‡ZE9W5KµuTݤEZtRj3f& U'u|eXTP'^} 1Y5TYLF\PWej,ܱ/^>"pf{%nД:.CO%c/RGOۻJ܄h:c%%v үG7/͓7 3tM \{0PNcܟ IM\Mk' c"ܔ(µ̽dX[ w 1KRJEUYQDeP^~"W׾q =m>.i[w[~bZ[d Đۏ1؃D+So;H6ǵ~&2AVG-;E.C;^@ M)(fY+=񶾆KP=ilR~1g>-u $$͉0*6ɩϟ wYq= 7BTLrv_7ZN#'D9]NX|FjmGbJڙx? N U'HPkv~L/%" kMjt*|HЩ/j T+,MJ>PC( ||mkyT<ӃFAv_M'|0ӄ:,u(`"CՑ<g#!KјPY"X Μ:nDRF)+lQ1کT׏q 7o&.cqh8l͢(]Tp:|Ą>[Z#qDϩ1kՍ.([J4&zo0ʹ*#Bp)DN~$Rkr;AKg'{*NM_MZ|)8 B½zCw呥$K v;4[unĻVV#Y־+Bz:UG-… 8jB?nH߱nqD z e-!!& fE{f?B,.mJzT>AQ;iV]&u˙n YE*f77qciY|xL,x6 04FD ]S,V("j-1nfۦ8; ^!Q8 f(jV#{sp}AO< =Y"&fAQ< a0oمZ+)~^$_iE] 89z&)AƸ &eJ旼=>d^qQ6ЦGe449?}_|^ՍOA=ңWqA01V?Y[Mo(MmPr1f L' Vޢ,~m (//M֮,ɊBq/]1og mZ@E^ TVTK\#G)GSfd3Wi[m&V*M̞M_~xœlAI;#jVR:3V]%:jZ~5$/a&GL2_~8<X4~ d@1Uò$l)9]UsɛoD<~;RB/+zR ^T%14 yFwz ,fY7J_576+|7 cubyHg' 0I)M6β/8Wl- е9=R=y5. &k`s㷉E  /^&$vA6pm? ژ@u>Eħ㞖 lv[>ʍ1KKƓH+6ڟ/^Fݔ^J.'%FBM;k-J) ,8bs}5Gs=h5I*G^XR/V8seb2>ϨO(-uq& C$4"Yl#jAb)Skd4Dh&iM{m+j0j(G9ExjVa$9( Оoį kKy=>TGd&`:LˉB3ʼn}r DeI/[rr0Y?1Sh~ :}/PH*;%ʮ^C@\P/PS1 v,/؀!Sf6{{N`fC=\ u8PjjDWɽcwP̓dNyһ r{{r4JO[@ex{NU |<#fکr"WP&SWg ^lp~JUv =kFb]-ʛZxFmMqBV'+td[}iU@(%\vq͛&L̫'̿/zbKQ`VTGFIN+yްYB Ȯ+7^i(XL+ul:f>4~]N;t7d%%iשy:``&=H5$#;UsC5&#GL5=+\NcX;8cU  ӳ+Wt|fGazMJlE仰4:Hf^z~R}LDnUg!W3fj:)G߰SkcMO}oPgl:f{kX-1*b kF vV1{6  FbCW58+\Wcw57MAx7bbWnK^p* ~v z+!Sg|S~׻^찚Zm#ZİL.ƚ.K ̩R֟Vi3ͷ zŧ̇F c.f;Q5뮗7pdО+]IXfS[}AV{&lelVީy0`tCUfiA~A%$Ro҉N LqDf`EqkՏ2⛪6 @"NrA JW'k-/\lj4 [N?9#u| Pt)a<-L]˽q=&@k~OƉ1̏9l72_",V] h:o'@garAJ:;G%'}l^* >?&3ăиWnń.,ey Ҋ d[fOch^ $~\*vtn\{e'zdM-!߫BN!e9έK| @$y6*oFqM2=3#)%PTɟM`xku}xj5ؚ#ZXzBXڕżڷG]eLX W }xOKh(vG>i? MAy%s",w`<W28]]n6!CW7iM734v{mWϧ{d>"03y?Dv݉Jˌ#x#F49)H~` -îb~%4b1 Ʀ7#g ᫨fP)hMEz>[q2 bttջ} ^L i64b9pӦ5&QPrܡfjҏtڪ' .cZdʸr|ƣU!Gxƣ}VU$̴p9CvB&IxX0OPd Y'7,ȩB>*Ty붹"5DI6}$,AB$ MgcϢdre,`SIB|=̋G(;إu^oTjrn:21T^X.}V\Zbu 2FUg!i4΀RECԨ1}P\X}]Ji^ Ո;jzuci=k@mˀ9s*p1.h\9`3!_vevLӞu6Uf8ZZԢLRl̑{xUINP$ md6POٱ}9)GP彐_Xa=hfcղJ` izlkDQ$W0% K;Qݚ<*a<=x@U AkdLCkՏ|XUJؒ̀ZEgNpNZW6LX7q!/dN!wzV# X+U͔vK&eV -Fi{=Ŕ90<\ReÕ6Gz!{)w}]KٸR&!LJg`T~f܄N['Q 6Yb ! و/הIX;Lա%M)H\ˏAP|gᖱ G,*lťE4@̾ykm{ :mf`*R~ӳVVE{^Z;ܣr}_<:AAzxecg5n^Z-~q; }6=P41;@2i'G #xZ@Evb&>x6BzFd_ӬJ@k ҿƪt]9 gQV?h+D;q=4*' KK]r%- ?B/oި_kȑN#x9sIUͣFu닩 [87T/XNb-!DR|2DrB RJvcʬJ7n?/uDT9m9y\N8(Ғ7ڝ7?Jm;F%u~3/ljF' `Y8 = %܌, u8tĞ VbJ1%)ٽ r*ɽzC H[nг>~cph`%CMTR˵@v4ԯDkMWp~ӎsPj;kAV]vx.|+FOዤ0[8:COԏb&=Wn,P!&4),i SDN".eSgpꛨK]:mB63"$lO9FKOmpA(:8iz24A5j&P}=49%OP[ ,0sz]Ⳡ }Ô FdHYXF4Ifr\L J7~\ذr>tEE1-8@Fh 4{ch}-YO?Hy=~r‹jA# ~)vs,@M|#.FE[UnLPgښqv0. Xyu%]>JUqI iQ,2{Ƃ̥KkܟBզ+P/"Bk=6c? 'A|riq>gxZ jw_ @^8z!0~2Bv(,sɺŠq"y IXK!\Q+8u*&lh%}00)/U$9XMJ\I &]ݓGx-d"dP(v֚HJG0 lD/` n5̴-#>F[E%>&wG EYYMdN.|zJ,O/E~ױ_K \ˤ?)ЌW^ ׶:Mys?-߼X(nk"@F{iZ|ګCJڦ.Ԟ={`OZû3؈*Qv'û% R%p9k^i[45839GiHO;t 3̠S۱j=[!+\ZJ+=YcrhkkJeg߽]^rVˁR gRPV7 Դ].7S JivI;dÇK($_ ozYJS<BÙ??RPֽC{ wL&uUboeߺz[UPl|kYOҏupNQ(xH]=vۮZ@hZu}v0˫y7t䫮|wj0nғr<&)k <4pS,FQ蛆ڈX~+!Te"Kl8tZ$)@҆b:cb&,"vVcfJY%Qx6K`@Gۥ|{Q1mRi}+0o=cf,כ"{!u:bIWǙ)gW^_2xQ*ްJRezL u]&W*#oe_[|LV%Hw9apS2`|*6t W_< Z>>飄K;U1>BS-]@w"P3zq_dmd{Q 4OP/t1)t=q#f<1!t"Xq0̆`^_or5tC39z!M&ZTYrQ>C)+i/ٜC(w}@c7UG'T(#0lh-& hb)bI@Unƽ&eP' j'yYjgz5)x±9 0hp ϮI,>j{bMO k­:gbzo{PVgIG 2Jm /PP>6#'x#lnO.ׁ9kpI Ş5~F?S";ʍy]<¤F3{JwԄs_vYD#ek[j<ɄD!khV6Dx2 +(Zw(]tOsY[ԃ޻0j0iwivu!Ir)IᴽY/[-jk*c ?٣29jbF߶q)tsb1 z.1#me_败Ql%1C:#9wt,FH{>י z9/oB& UޙSAm;˼C=1* b-^ma%Z=-iNV3$HC8ɿIS.r@\n5zV}QLԂhG GƤQVߎRL1kq h5#O:-~rէ:Baasoc?o0՝9hjEg?;n7;`]S?;ŞsYk_b•N}jM  uwbC -дEk?rk\&@uiVb{)@CZ%&EJ>#zX)i[Uzn8ɿ_lt qR N߫y%8cA4וY,:% İXHjjQr5WԠPEIWT|G`7>MX VotB}ٌѷƓw>4a6h}vf?,ǿPfkt~=p=@{ǶP|ʁ'MôhTM+ȃ&Yǒ)ך8hjds;TrtSTB5VTN1 FYPKВru"beo 69 ԎV1k/. x_,5BRU:,c_MVRQBXݐ{f/}Ͽ/lܯwj >p<쯾l0CsP$#LC"\ ^gurXHcjڒx&]pE73+T 8`424:Oy8KBbC4PZef16%-l1d“3IuVm`?yڱϬ7CCqS"u7Tcٳ:])U:.c~x')L-1jf:qm #usTh"txݕ_6{z+){=L>Q s 6֪R'?H{!h粣++:ܷ77 oZ̉ʧa5  "^,iح& $ ap)Y.5po).= n8(eF| ܂j$| o4]mL;Ԉ\xԴsBVʇX_]S-j\+A~ +À dc я`0O8F;eL&XG2j5g+Uꢻiڿ^@0J+X(d;IO6DJN{o!=ﲀv-!IIkYPXαv |%&pX[Ly Pqf^Y! ?QS6E'T;X ?g󁀟L ukɥh/BMMSh鍢Cm.?<#^M$)&ZZ,KDUJ|,[/wO ?j` }b{B92'ODb$0 F0,0P\`C4@~;NztݯFq( _>0ΐ*k>*w^6DNt>+oӅn;kzSR_!*;{*hPcQmHe ypZPՐodu#5~4_  ]' z5iN蹌.O%ڹ\:6s42uqyD.|[&2n7) >jߟoD:Ann,9E1Ұ8(?Ѻp:W*/#Q4A"L#%Hےl`O/DP]h0+|Ȃ8ދB)y%e^K"~]N$k%X43iVpCHOy߁Pʁ̕QȈF#Y-K:I>Cƹy{oJ{Z+ Cd/G쪎xp/t&GtVӏM %^#po}E[T?kuɚ! =wǚ mP3J ޫs#t1}w+Āx/}E@*p=XD%E¤>׭@] J[j֛"/waƸBV>> (Wpt2#qI_ptk-}х}r?:'l BNݜnDO-`8Uxh*.g@c== ?! }{}Fo9Y=T*ba`1o>s2mVt8Pd)fb9/ʧnf, J͍ l죆OF4S40NoWA؂# _sDk0m3;ʣ'2;Je#b8GPك" )a.B)r? D+iEh 6u],_ա+`[)ۆ;g[J?V>HuM˫B].FFu2FUVu+ݣ_^^T4Pv) :6ͤ%)w-oAy]${&s₍t LJTC\lq X|O_Lsl*WF^_=Ή Zזfx6* E1.O7z.NyD) O3ѿVՓ8s&eT5{I׉I Nt Ʉ{%)? (c59RoYs@!4yrhs W1?R#%(j٢>ZKdTEbi ;Hx;dRk#3P1blLM쿞 ب hH؝ 0F|vx8)x,Rs]Dr S2CȚNS]b1!m=z^6ņDO5۴2"K:~myz)"i;OΨ"1@xkӇGo4p0ƻT%xXwrpӋU@ piU0rpR#DQ5p^v$|͐v7 &[ tuBJ?[B+-RY7wB, E%mw> ⲤsoAےi2dˉ#fX68#o@-8\9.*>+޻'R NsQ!c" (, )|AL4bDiui~|d#._zK8uk#fk\*}/U_`+^,\ӢmHbRFfF 5w)D[ ٺ)"y`jxǯ-f#'TFpBEȶr ԒYP8\=tnjQ[Bd%Z;)U/$!q˩ sgaٗXwWגDfo{^4Xܕ-RDOʵlk2,BF5YH9jq9$a eg}4r dOl6 BsB6қctC9.6]ԯ&l~Wgc& ,i WkŸHOri9j:Bm3-3j;?N5BYkd5gܧ IgdñvV˿(!Zǹku0jDwK*pYIG1\G 8a/Xc%`+ αXvƘHzi>Ę 1w] o.ۭɓ;pKI 7;xhr4*pkcV06M ]Ѧ(GCJ0}[WT **7TpUa`Lt\}ZTڭ`ֶ\^v\AoŐԡkJp Y!6,/ a| Ia4]bjiknnԚ #싥"?A9Dfz -maybH2fd>B4=P Q%u.asJoMپ\{QqmNh,QkJAI՛>5 EԴ[TP$ilŹľԅ[DM$>p ǒ"9/C{"qz[&4?I_zwxmІP)uvam#d<*@KcƚcIID ۠8lm=6±},s lhR+C Z?C\ ؞m .qp"3-?6#Vfil2ҺRNa뙇`y5{3L%Q }2q=!'P MA<$o>$Zn?6oZ5,:2626o(U 64!0jdu7 4Wa2ԯuU5jJy.[(;6\HlJCSvm& p[`1@ײ@lT̐CQMs kۗl/TfeDa$+m @걔 MӈnN5E._;b+鶣'Xc¯ɳO"cGspWl|cK)'8o:3U±ʼnG}gTǠ |#8& Qu}M=) 'fUc^ e;cG*ٝ P Oƍ,7JrSͶQw[Jӛ$#V vنXq7b.1B30RH#a5kFjlWŭ˜{3P$o<,3-)I`hX PFQ!Einh\>\?Y j&ʓ:рX'=wȜC)u_&|w'>8VLjÃgmwʭBt vH-(8dZЪRMsD0:6)hg0@*)ZIᝫ'P s74$;0oTƹ 6滋\-ƫVMhIi@V4*ޚ2i\8y'ޏ[:f;= WdU؍Ayoiėuxf[΢Xc ga$4?ظP4X2 9 ~EYDk`Rb(: C)Dӏ3ьQ^ms@Ӂr8зf+ÄaY1W_-c%5D~;.6ŽKϓPPɱ6Z -]D~ ͠{"TqYc2ƷȖ>QBm6oLPXȮ;%('^\1thzIzȸ/ȋEd)a}BYAsln?VTN${Mnn%YGߜtʎuSDN_mD Z9 izu-L"АTA^RGe߳f-e [$oocl@2;H]P)lb06g  òi?c7.)G(;i]0j^S|g>FsYo|Kʓa'EZ]PcW`Cf;:dUkK~ܼc;EzA 1(R;)(_p[G͚"KQxǑ%_`B Q A>2=.+"wB Ŷh0$W?Rj]x2Uzdnshv ҄5ް{:T۾mI;>&x-NMzn5Kap. !gD1`` u{:7)HfRm~~_1bBYp g_>.-=tl(Vr9lƳk>צҁ%[bo-BV8w= ]¿UZE/4/EXo}l= Q.Vf49N\ "|n?C?Co)ŗՇaB}F!pŽIQa# D?Fe협EZ,-.-Ũz+ aNe[g۠˷)m|cА)[ 7ѝx`׆/\syMvFv|aM&_5 RuҬ!>-cvnbE$'xI# ^+ź*1Nj\.6 I=*Er' @<s͋Rsb~]|d*%28NZ'l mmh>8lRpo_>^VՆC._W^5B1qb* Qc6\O\7:+_N:2 @0-a9`Zu2,z)gA_TuՏIyH[lcY JNJcc&IoV4[5c8l {%^J1H o)6{nïy׶ݺrjL'Ӣ6z @}jm SDʍ,TT1Y:ʭ(V{rhZ-VQۼ$ԛ UN%_D~ӐPPǝ:l@KpA&QYwM6F%i?f1>.$LxpzO&HLL!A{Iеz:)p W|*6rc÷$x3Y QkK߈wpJrr~fN܌"j1r^.A<;EĪAKq LR~Sb]hO4:>nJHtu~-Q ]HvPo뗤?hoOY9P6k', ̌Igb ,|P Rs=J"EǑ3:EJ5c?^A[zҗd SMPjԮZU*1PjAfn=-˼z2Cf `k$eClzȢ KWel\XHŅc!T5ٵ9A$SjXmЩhl@847MXKľO4|UP1T?bpbfT U١-6c7g%a,_s@ zS/C.gk~xVN~zӊĿ# )حgkTPvcR4sIѥD}-o/'`ڐ-mw9zwǘ:d 5/oMMNI;E )6cQȉGo%q;a[HMG%Mg Z&Qk $-!؉MNc.4, 9o՜ )'%(CZ0ݼy\ĹƈmOYb*ዝVJ)s 4x[!6B[QF_d1ՠ/˨Nky+v  4ڬb6vr`?E2ӆf,kYK%_N'eo:?j ̌D2EeFmj[K-!Khkt,cOO?"%(4jmpOQVx2 MY%]ӕhE[ODo5Co- 휵B4 _AOס'3A8Č4蠶3j8xp,i|#}+TYR#-^*$!6EVw<+NC E(>^эi¾Zxk NijhЈSP>@3$fHd4;*3 .I8lK XꁓکX-: xNjU4''l~CirUqf1/L%IpQҺzK k^ wECs%%cwo7HpbDqKPxtv"oCɾ+y&NߴekǏ :+H15!’㤔D 7DY+}>8Zc&oG摂$eqp!cnj5堵/3_}E`]Bҝ?nə9|rR2 Kg95eMK u#ҘIv48@;/Ix 1d2^Ѽf-C#{c %nOۛܶ3|A)lȺ(uՔt*:D-z/}A%tL܈V`NM:Na 'h ٷM:3:BB.nbnEKmZgs.սx}[1;l8.F, Fm\vo ey>X?y]̳3-UtxbMS |;z}.êQ-y.ڧSb"^ Msႉn@crSzGL3CҟXvv,w-(V6ph"*#u rG,w4.)V TŰtC\qLi/~V=y]녝嚩'jcޔ"coŅ;#}OgS\jtvA ^B7 ]寪v@.NfK> FĤ9I5lՙ E_jtӜjk07Qц&wƯ|wL .AC}N9:ZyظO cg%C@e%\~@ 2?д|!>I=zwy'#[G Q.h?Λݝ<ַjj@[&ĒݘO|gr\wCC g-u  SDryG9Q*N;cIVXI?4[ g?w'&×jttk$s~t%q&;ʼn0jBmd#-A6 nz !8}qcѧWء@yЯNs}6B61wlS('QweΙߊ^Q,`&LJKP(M6PX!MnJCta P.f5)2 (vpY o7n (ISncPþl5ȟKpQ=?D1dЖT-`hH FM#=kEMoH݋WXSV-oK!{SX T*ç0Mα?8+hl|o;6 2`QA:\ٳRVlpRhx66\::]" ᲊ ʻ`:Z|^2)O g[sPC,pІ _ř%St4 ;3b(OLx+IINiY DQ(iUiYHdS=-c(ҋ7 ^87_+67S? ;pE~V$yFWB(0,BKH٣ABLE;5nYM0LA?/ 9Xu@ݬ gݟG "h 1(~9QS| 6#JcJ} [iݨI_М gub .}9TeG O! ( k !'vv۔. L1zD YI4p+iJdH=68-H anmxeT#p/65)3v %v6ԸRTh;n@tNs^0cRT@aԲI{g}4=]O(YN'* KnT2ߝ LғC4בEORDmCgqs44X +* aIEд>qT1hx@@$ޕ ; \c>l_!!ѓ]rw[~p=~iM3SnPɯ]ZDdffMx6Liaqy#Ҙ%X֔o,ofqg~)JEV>bU"xbOڗECb1)[ HbQYJJGC2FYurl<ץPd}3qCKG!z-+!uobC9.dIE;' oR  ,Ԡ43.+r`Y O2~cOqOyꚬQcg!mCP]]hmq.ؠVWP{`VӦaEɯ%Jw;q Q3(v5f5l, S`8R4y2Gj[zg|D]|8?$0ގH AFܲY~50ھ /^JHky%!Q%tm`.VP6vA SǷh#P%P](~LH쇲:S~ٶłqۤ, D*tvB:20 هbX[9 np}0h/\ dL|JE)^zn3 Hk |Hzm*_s==b2/lFꒅ"kV$\nkC$jP/1 _s0(1$>2$Y<̕d.tte"]aƯAm;kAJX\3>G!!Z*SyIdU I|L1ٺڷ]{`^7¡W^̛cW=7; YFZe3XS+uxf-OQuxA\]TO⸱[S돥ۢq&w_hpq{qÃAr7-xt,hV ,je\GH0=7qIM~4NrK\(,N.c:5EZ%aLk:gl0 9Gd,Z5JߘLMw`S8,w҇5ܐSkދ[WJW*. {l1CQl3,zN _V9h5rmRբ*"wcmQRy_' YsT g/ZTᦦ-T Ro.B {!"#)n`ei+XI{# I+DNLRw=Ktcj,x=PjUUha3tw~̓%vt]2ls;=D[  Eq60y49 uZ}n]x4 ;g K?bN;a >&aZ`m U!\2PB19ٶDnJؒu ޛ_R'cUMF)_>֩ +[XܼKkv*.14 ? gE<B}Fմ4##^Mn8J9IƉzx:nW,,xB@ eJEMMY=_̊$R Zϒ8ՙ1g`!90;Zݧ8W_!Ģ|TxVW{p7dp];@9vMH{gRuO-I"& 1wӄTw#bM7+9BE_(YTƦW(2Ŧ7jۓ>JqM-Ԣ`|4U->g$’.Z+>X)5 @Lg:­ZѲLuxYǵ]!Z :kVȱm+` QqufXPOJp@<utn©It֛s񱤂en>;ǺmFF. m&QΡ ƙf b 0*ͱ*D}^5Nkʷۜw\ؙ2Q̑V2zUo_@,(M L1Aش?A=aQӄkub5L0^%~:0J!6cMkn߼#/v(Ң_G4_>GcRI| ؎tP]RWP>z)T-?;oIa` {?b$iNٯGZ6si׾5zZ@8; ـ,kpl_aCU\NO̫~bpoNߨ1v-)ϾؒGcKPc h,n.!iug.طpΰ ?+W%trE&i^q&Hٓa0(@"<G=u?ɞZdzһ|ެ,k^2`SxH|$h=h~to@ *H'\qd Ȋ SQ&tw@%;NEQ0 PyB!aC2S$4a'VJu#Qځ`9hKƌ_0(7tR8m4FyBQV'3-YH>=7W|\DI߆Kj-LHr̈KyAŽdFSBZo!aܿX =!JIJ d] #"$GG|=R]L#6(g3Α~qF6t5{Q!iknkt#mT b;a8 B!"=gk{XܣM@-h]:ށWMW>0]܄z.Z.;Qj`r+nw q-̼׬][]k*iw%Bf i +͹pZEgxzP{3_K5% 04ZRފP`hEs0^ĊbW0xæ/'*N3"ح[0nAWQ6 eqSwYŐ2\AJa.A*WdO'SWhˡ\n+hhm.F(r!Ӹ啻7MNp ]_I+5za4U3aj9ord9#6# \A1h1z^aUZrU5`O 9U-gGAa39GD1'Q$9wN0Q松^gC`ؼX6v'"au3;B 3Ov)1wʸ3HCu:TTon[Ѫ$~AQ&҃ yd<7|.V:xPw?39md9qM㸪jwNxAUͨn5k+܏u REogs%Jz2et/Md 4y ^X >Kw)cÉy815̋dBӾ {f0 [{0z_0󀡇R]̸< <_%0xz\ &|E]1OcbL6$( pSⓋ`[1x6R:ݶk]DB .uf0-*NJzQ}~:Y73ב]VCxHs=̥۾ni|;9RjcV 7m{9YIp+TB{`4Eė.)00og 5 PuødsZnCMXuak5L^ )ot24Ht+ ,`7\ c6=8"sVx8ѰQ;m+h*;܆{,H`죸*Sdf†/jF!Tx?-zչ{;*Idֵi}[/0QZ+ 綆Zu hv'S6QBdžӺP/q5H =&dsݢq`tNJjEf$nV jc"}Īs<5IdvkIk6e)ʋ֯엣FDI5lN8qm |v'}TڠXi%qBxTk{,o‡*!]ƫHL;Db~Vq.P2^!%v8W`V?R wK>lʃr?bU= <av,eE 6ߑ$3w#B޼-PkSp6< aҬ1I=tFG `:<"4ݔ澭v': CTڟwd'5߰R@5>d`%|Y I|тoB/N}$ݡg 5B t,:^uѓBkl; Sssem )`+8Ist\OtxY9\[2P:('>PdYt_uL"k+r(-N|7zyomӁG$ ?5p@5獑 NYdtJ4cI6ѶV]JGu`޻j1XB ri)Pv2dt՜+rkZȯcBCbGdpwO>B&=Gd ;3Gx̙so  4XT2ƽR tgŸ'xv>IL+k^X4e%59cxj1ޕx1B4yXhjdü?t{2ӕoFC2q6C0--B?Y6^y:v}SDJ%̫LX5vvY%q%`Ǹ<,p+>w.!|Ea&jfEOkWO +a݆]2: UGf1z%llͱB(Dxޑs9륌[p'5ڋL5 -UU~heHrd%4Q 1Kn\\߮zb:q_V?w3T&0B=sV/@:ARw JNO Yy[o39!O lI@>FOۯ߫"J!@s+7)BSTߛZ,{9t}g3)vC >YNM.p*|ewWEġWN 0yCe Ŋ!j7%-TW#:|V>Vot\VU];p{^>Fx颮3L ;++9eJ)5!ѕ_AdA U'qPFrVn.QBG'U?;Y̳B腽6w Fd?-\3go7EvVXޤ 8ŝhŀ_h*5rFdEI9'9O;$@E%} 9ݜt:,xqtF6n qKw ,y0y3>uKq6k %޴*$%TYj`E`Rniti`PgiǴQf33New!w辭$ e>{#I$xlF?l&~nP9EJy uuArSn\@C8u͛qlj5hp5aW8]bq&vB4$)ڬ^ܠOF*k9[FJݹ+n" EJn aMxjHϦ\̜8(xOw u)>[ ձ3 x-)dI5{)$Y&fЄ'uͧ"ZT9^OL 9(M+Pt9hnh46j=r}63&]MT[OBj~h+ /.*5`މd4t;{э) S6xR8 s:r)Ĥ4N?c(V 8LxQi4xh ʛGkDkOKmgq932E[jbf$ n\A}Wa rnFc ]fR=$# lQuMbc4\'0hfIC7{mK5s tE[K>`6BÑ;.HRa|^yp N'IE2kKgv]=ɉ] k:AP R$ WN(kAP&䞒? ymZh3df-hzPkL|F{g$raS@`kQ;{l"56Dxc2j+S{*f&R3F2Z EF=7*vE6U>I{%q$og't+`+F)zr0~9O (S[o6/Qs YGY&)Q%ia@ɻ"<^a(J.PIxd *Ǡ%n"sA$z5@*NȺ#,CZU7pfaa%Z|ꣿ`h݈lrN] f7ɩ󸷞B` |OB`V {߃pS w*9=bxțF<8Q"x@係` m[@~ ;6cki-~^sbæ~bgYE` S=XG92sici7 hxqV]\ú)BB@zq8rA_)-˗!X!ԐQȸ}04?/(D}7W*!j͸ޙ:턖ba\W1@OP.d]cygKp85^d.ܳLTF. ֤"xhPsݙl@]XJ0(A%3_evQx`FJd3y=W,LG y^e32̗@4Z[^dx9H5_mB`Ŕ@ %DxGp~I,p;tb_NE Fԉyi  I=5uuRjgȧd<3Y>D~zj% cL:vS f?gnAUlڴo:2|{YW1X3f?B;dQ/c05_3EjC4z$ =N' 1!GlAǤ<:@Ђm"T?m&g @v gTb'(+QqdيDP pc f ~ m^Gi#qꇘOENqTզv!ޛ:e h  <;Z1YǶhi8작1B*%nCOoȺ-¡P觝8]1EoAl:7npaբtߐ3+3NQvƋm\ R]hf#XqFDH0'B}Jm1߻)מ|LaL;IQI o*aUP-yhN n9z"?ymFf׈k9eODBnjGSTPDt G{x5urNѥ3\$3wکkբ f< NTx;3~H##";JgԉݣcLڟ:FNzo#mW\gYF];DQ.uUGf{)-=$տ?Iw>~bHUʔZU7jq*]{0ڼh]AOGsxje`{`MHA8ac'2,_`n3U'rr.|=w5|^/_JU>Cnh̞G)VPKh9"o9e6\=L`vw >6iZ]!prs{m08'Ssk;wnP.S:`^ީs_R2eߏ}i.SBqPq8b7ks 8JJR_57sp5 $P7ύD||ݡx ;?}s3]W&1uw+D^swH:*77&}#d 5S,'5^R {Pi8ۜgC},0u^05^~<, BOR:` qᆳ@@}xלqo=4حB莛x4;7Iu25M:^r`@f&-8Geo#a2ŇYq{X ̓m܆433o3CW+ 0\o<JI&O8t|iV︻R+5` ePtgmNUpYI{vt/^*^Fvǀ}~x1$`kZ'k*y6֦\eQND1{IDP{)5@&1Hd,5e8Ʊk^ zv <{_}ϻ K=#X4@]"8l>T|vLp|zJ І| q+W|xi ;:U+Q>& $fms TeMCmMљMP6 uT!GA'dD|Tf{8XL"K%=ihp,5irrB[5y.I@76(=(P|2DԜy D}fj'}1XdsG.|3˶Ytಠ ̖_hʷ>LYŮO F!ZgZmlz͖ANXc{B/3 W'꣬Z+є$qDU| /y)qJ]،m8MRkhwlf&kBDjR8zQSXhzDWw-VQY_ 7_^VZ2ؐMԸU5d&jCOxt&# dLFܤ "^ mڌDk)p݆Q.4-UvB0XSQ-X,PhIg]?`]B*腻gv  H3}53#<4$lJt `!|rujXɣ ~: n&ri:~[_y9T6b|w8KX ŮZNl~3Yj5M yھfKW2\Kw1le$LDYI s>j @C'I" z.'6C֎sNV NK oҀ xMHW> l \s&x(#U:+sZLQ:*j|#YZui"fPJY˓qY/5#udl$xVyW">@®LyH5ŏ{9|DuWyf9zBF#("_\ 2ƥWAtL]@X?~ $#mN@\0@7^K2$n:IZIM%CE9eůICKyewWT+pTMo1&cK&6FI$0k+6LڹvfEOx׃ߏPݦ6ۑ@峽h\h &[ ) c p[x]rVoi!JwƩ}O<*j|F^ Q?R|i>7sG/LuN? lt@.}Hsm6z!0jŮge^* )NNت: 3ҒiX$4i_84CD] Hyub138)*b߈@Hپ9YZ ,F1N̝c}.O[N>gxGٝ2_>[NQ1? WvWWjɏ|g$ $pѐGo ur91q- dHxGx-MM'w8RWڙ7Z{t@Ӌ!Y@X4ʐX\b=9t Zr""( swjއ ;\2p-4T1 %(ҋڦx_e#hԙMCI{f6 txf1.40/C]DkBSt:B\ٖp25nZ[oM"ĝ{g}okؿӛv݊DVj.W.rOtc/uމO O?ių]n<+̑:unA?`L3,ޣZhDNѓĀ~uȂiWq]%A&ay"*e#>!FRTz(P$3"Ed@Hc`&(|>+ik2a¡`%L4)la ~zSCZ$$7bOOe>*6mWQS%rTOd=3O[0<(p'nӯ dsS&ف^ox [b381XqRm+&|)JMWҳ㽴c-rBȨ?XN.1K-gP S=\&Dٽ*!fK< 8\ٺj${ vK w8764aqsdk8%7?;-/>K;qޏے"Ē2) &O8"RZޜIrd@"ڴk Im$/7M)4ƕL<l%#`9e -ě4w`[I Y38mYqFFɐ]FsV!J <'pŰ2[[tAIհUNK@QbfbFh–M\e)w1 l8}zZuLBsm5qVp6`o²ȆZ Zg4RQL}[LP]L"\ؑ(b4=e)5f<{]!ppۙ=]Hg SzAo.>Pa"Qyfגt֡]9mgO<ƴbaLM33&3Km=XWS/1B=n2KZ"nKɮI3۸ gMn}ffWH$ D1t VZYIDCkvtּOA)= B=4agryM X|u; 0nE4F)[[@$MhݺqY_Pg$igAEB.kXad.ZK֙r! b8)1[|1ItvNm=WBe8-٠n~*fܙ_ƥ*/cF`)[S>ÛTzȏǮ!e6g!J$a$lJyUgX|:j9$h>6cQ|&q'm0XP},KѯT';8&*rKI"8mRHhV+;݂-/@p/k'T[~=vjS32dt ja++uE"M\̡_>ƶᰧBsٟieoh1'uyxfQ..1B~,ӑ}2t4'ePnf9$z '_!r!hYfSF4O /5{/r]uN6>c #x;oduE*^R?ZPG7nhDCޱnTO{`XY\_Go(2 Th]hD Uҷ$#(m]%nɽT%\ҋu,ޮ2ZXYU^-[.֟\\rҔΛ p\BR({a0Ձ-g#[I@@qdBPL B4+Lo*}hRZX+]TnAK>S3j2%Ʋ8љB%և+%Y/[TW\|cDtv ' ]T4^d{ʶ?llQre~GYS)B~`\ 3l` ۈ1 ')()ؑ͑UkRO{l0ۖWV`- hy@ 2u::T 1J}FqNowTLԁ>z纫 6(z۳ZTߜlT^}ea\сrKKׄ[g[8Jj8gQAGj(jy{,ˡ~ "iJ(CGC̶Qz2.oLhW@6I'DgXjKwhyme' 6.(P,'ZrxBcuP]6{6%3[DqWfID eqׂ~ #PJ;%ɗZBz@s"+ՂF]ܯ&s;#! TOi (Ĉ7Qj Ձl-!3-ٟZIelIE+U]%&,{QzT7ATyυmN%I.X)+BNz@=I-bH%#Ђ( s'9|gE@IC̑tE4v^k ?*A :}8:RN^ӠO};ۣf&&R'Z|1 Q4 #u`I>X0<#]}^XJŊw%>d-htw,n[+ё:X'1fǨbA~N|TQn&}Dͤ6Ôfl!gic +f0~3+_y( (ݣd_"Hu0Qho~\ _+uTvTP\[. {qz.dMn& /V791;G"I574jЂ1Sq`Ug8[øaݏiQëML'[Jk@:]+*Nj(Y?4M#7zU_DpwƒYn4\NPs;q-wT ݎ2x(#g<1(] I$LJ\}) ۠b9Щɼq;2#NdeGM ņi D`ΘyB3di0Z cdI:ڇPPPja.XT5H^Jy6F…GDgW(6q7s1_勤qΓHR#FzX<vr*) RtwVq  />]+bv\Gj8;R\ֲت%=tq>fffBN60_y2v?|k'ۋ{SPilAG&Wk e@>&FXĜϨK\ `5If~C|T=''^lr5tŁ̀Ca3x^Na+|8<$753)MkB g?f=1vjaFiITB\H&NT>0 HOs=aѦw$+x4Lx^@Zƨ7xvB"3[gqԌ;wZSxA2x{H)ų|x#K"哋GeC 2Zrq1K):L 8ݳMyӢuQf.E}ֱߜ=Y`GxvRJ&UG=`0#'lf Q*IGFJUEWO][(N5(￭y/RK"!/R$Yq/SsX Ǡ,d=ń9':m4,J # #HƢ?DJTq~~Ȓc 5 *dUn=L2]*[EhjqO -GS XD}E w|mV KU >%>r':Ք2c]ZS H1>osLw}Ғ5@#07>LA6wjGO]2&חer hw[ۻZU'K$s' /bPd&C@M9J/My DWLy  4 xTJlYP8t .(%!+s02QZ JVͮy5B?&"5d-+QE3:fléȃX<n!1q/ ~H!0X>2NБ4xd\'pRbӐ.0_$oԕe^sKyE@ެ+˦:%i¹qEjtJ %͡d'V(l#q؝[TrO ω&EX5 $]c: -iQ6 xM4j>x ZOWM̨,CGA7S!uI]i,3ާ~GŊH,f f";}$%wճC"DlەTܘa>v|WI7٪S'[nҟ\0ێ2MS^¾RAߚOwU6~/f$m)A$.OЊjT "ιxV^ĭ-pk KdG5y8/FC- -w_/XG/Ő0f.X;6 uwk6M3qĐیl2$f d b0f5̊z9,aJ?y:}_2ſjL_~X@b[0   FC/,A=k _[tf+5$!Y N^­Yzd_1C%TGb畤q_QG#ؐAt\ZØ\рFfr )~)@":F ȭvSɆDxeX [B.2YgweCK47ޯƝmc%~ I<$ē=? M /bƯߌa'nnQCa&Lb}XdV}kf< a;)@`I)~,=5.OLȟԑ! YI$eso~,T)|(E㥢sps(آX(.ϵ]9G%\wd \F]a* s^4cq54 ͊s ˫nъ_V0KdpOX[pV}^n/5[ i\? A땑d]gu$gfySՑڀ3?=v8C1K0Lmך$'JzW'JHXf.wH(J-1+iSztd1xL89#D_U 4.``1 J$d!x9 Q!s@]HH(@_*cb+xby;v }GNQ8VF(@ H;##$\k9߹I27g6Ww%B"ad-$5'k[8)T;]d, .3NKC 'be%b0e*A⾌L2` ΁Pg-"&%n3 t!f:I o~TNW UJ,7C+S{ǃw<"Jy,k,J~Nwn^hivD !u-ߒ{cn Ɣt䅡77r7/ٟR`gBEM MaCtRڮfn#A'E2sus7sa]%- "~\VB5!ֳ`CZH(v\}8E"xM!K }AzW-Yz8 5P// 1myh :0[:\yzŶ_쇴%BAZ=WwNOo_t_HvWޖ]h:2IEI6w.0 A"ZPx>$0gq0 h('x6vsm)%A:ΣS]f:{w}&o_T/RlݚYTeibŚÀkd npjjReW߻da j0Әy/3')fUF٢!!s E:̅Q^5V`2%ic\i-Q-S‰_aRg.b\N>ń l(*! ֦*x MG=LvIJKx'f ooe"ߺAAb.fQ'.kP/.+/r {:-&l} i9Q`wcӶ4mJIU]a|e8oliDs;3wQ"TnRё)*(ov&2琌9#/D]cm 44zԥMpW%[n:#Z47GIXN*7 \sq'B( Ԋ*tDShqt( D۞Uu8|Mhq@/V/)QMv/k ] M:dm}UyZbuJZJ>ͩ1Dj(/u*ؔOPmJ, ?K 3=!0nr+d-kk~$g;5d֌MH yB8:#b^pOdu{in JqFˈ5Pc|D+mrзTO里Lœ#]u^])p$Ӡ'[qiH9v΢/+:I?k84@iF:^` cY_;7Lȅ~&0dŸ|*mmeK;l劍pNNyk3_2z0 \+k)s4~? 8ϮS =06 tN7-mO_:JZOr߯zb)}ٳyEU~OQ"'wⶃx׳8@EKfD- 8.qk}c,^.emɝkEvfmRWUko/ުVEwbg#=ale0UnAP ߪj˶;=b= x/Qp0j ٠P~B,Stqk{p6l3F Thx\KQ(2$<Ï)ŗ2~Ooh7q8^wJb R1jR:[g1qϿEFɛa.z}k&$a,Oٮ+/Vҹi1ez#>OT ނT+rrN8c{lŹhfO7|ۣiOk8Eޝ+9e|dt *y:D%F OLfNxeIhd$QUcK<~huWDžw7m1gkZ~.-/CE\Yo#ep)Z sU}K$L#"rb%6W2F: >=ξG܂C3D%%muɗiL8-vk#ȾBE5Fk0aι#fi1o%d4 u)H= P38,1`5/Gl]FCe3z]I ?P71J8ü~]]arz#Raig3ؼHOAPZ4p V-D[dYxvG%bIg uZux ZBhrGD+}e5 R֧̮'8l MlV#>)Э!B} xFkP+q]KĝG8ްj*6 H<k4Mkol܆)Q :hbK؅: ٽJ:OƉUkK%K)Kfx~3.kRWdxV˫G}Z`Vvak=tayY̧M~鷁!dPJZd -g *Ӊ6ğƷ4~#.6p"Tl =%d\'Y`lhd^+gNŜWr\Vu7y8ru_ ?w ]$zfﻞsk}ɜU6uP͇YAiOSR=(UZw؎1 D+,2y0~}åYѨp7_C˪7;{Kk[$HHhD .ӂLxrS{zs?[i["0H k+ę38f/vc˝,h5AO>>LxAi _TKɃ,Sכ>fѪLNbҔЭ,ceeCʝܙd:LfanOyvJ/mC?0XNa^]ڞbm̀sʹi–5E3r`?K`ι7Ł3S2B'/ 2kǫNذSMeI">7_J!*k)" `IC5`-sF)1aho0IA2[W?Ag}yP`;i׀Y ^Nl!vJz626Tu٤b-] +[i *:0^"gC]YA~?8+4t,e"78jʯ3)K.7xgC 5>,x"V(UZE J.ôE|O$AC?&Lh\M;fhߺR\B^i\m]!>{\z}Q,R|9`B_ s￤eny?m 8l)?ku#i9 @>CLeI)w֠ _(2KYnMpkԪCn69֦kW Z:KzB%eLt8-%|@#[)ME T 6[GJP+tMZ 0P79c D톕L$-YB7!6~x|*^y$ '`qb.J>-@٦69g0[WMgvT\K!DoX 0GUn 3c`<<%3(U o$Iȱ,Jg=[ Pe!K(63lgrg3.MWm%9r6r JʭA#1$f ;-2̦ju2JW`"`'V@<J_,W}B0>:ք#*J*% @`γqfDoZW?rmIHF~S_OlK"lU,{rVk#xR] v+`q策e6@=%~ɇ*(-odI-| :C \۔H۱A/%,~ղOt̹5h$r|/1[|p:/RО|=xɘq;~>8m]ʽ<5Ѹ9r }z&uL1[ Xw:뇃:]nsԉ_}AT'0;fO|ײw%ʰCQ]9BFE8?Wx2h.d#G=D9060GrX_gJy$ \Yv+gT+96,l!ރG.|P9!ήك#Hj ;o4G) 1d5ie4Qǰxe~I;",=qU8Dn&EEcމƥ<7z]Ќ "g$P0Teң0m>2_iPwBvFxF]fN|LgRG{%.gvo%nʖMmB+;ӯh;h 9 x/yf_H6 F5]#yHx+ΕG>!y el("V;v"w{ 0EVp1,!BYm(9:J4}tWbPt`պSbR3/`pX6z,iA>SwdYhq q?W3ni⨶->& a*`Afg5!G+l<\:i Img!ҨWdS[)߉u``t|X0R11{qM z>jm |]!tX( I3wv6Ap6$q~|ϛRK|!D9xCCE*g=LArZE_'*M^}vE8@NRB̤##'ϝʾLd\R2 AvcQAO?M:ny1\Ԭ枭 )u=3%*Y^63, u5Lsؤ 7 k@aJ;>&T.x̛$Ϭaf<5}Bƴbٸ!n26.aM"gZ4<7^L5&)}|XX MHĉb0. qT+׷?wvO߹40=~L%,$hE'æ6œ:8'2 3)/t%Ȏf.b_:6;t<=j.ٍ+Bu\Y]ﱳ h$q4zPb3.s&N)mt8Zx#8skFioBVZR ǜ~t IHC}tlqup"B䡗+nJU9uf@` |;tj-.` HŽ뚼5&q>81BtdL EfRbn9T e%!sQUW46P ikvxv }G3GQA`t="lD9˪l+g޻U{`Kԙ<,V=O̚p@b3N6m 洴~8~?v)TUCN3A Gզ.Qn2nXo(R9U=dq|I\M$~ Θ0–P5,cYǾ=c6'1P ㏊bc f3:U:jxmݫ [ett/Nח蜱\lni0 +&hesY1PN'>i~HOr֙Kt ]pXD}YPΤhv-U ^?Eos].PHXN^la8m§o) K8vm𡥚E^"y]Dhw;k2) 2iYW[,G,8\0?6;AQHqqx Gq(ׁ8Miǎl bk<|z]{F1c?>З\/dͫ:1]c5!$&RѾ}]&N~pDmm Gf0Rط4˨'#adT"ŋUC]q龗~=6sE7nM xi^MkΐqԠ,sn [!|g4@ðU'*WeB6e}ӖYy* 0 f2yIHBx3gۋ[z3S )v Epb9=0T]/psR5̖|&=3h%.heSĨ:xHQcgs9̈WK}9lv[k`]6?^Hf .ƑgIJQL=j&&hj}4* CΆL3t Bk$0eqٔD dCJ0[ƛmQ)i` 3+ 3ۣNFN/(cg:0|Կ:z p:C;C5^f%HNSHI`rg\0.6\Nc<ъ\xN_&+ӫ!e*#F~UqoCZZ5= g읓G0V]ۥCl_0j'Cb&)48)hsY>$ A))~. )|Yү`J}C'Y݅ұx>{k37W&kkw,9^EkP;fh ˡTN:/{Hc?BJ(vjy%R(r:!,5N+㋄qɥxx e26Ƹjw$s&̩.}0jbr?N;t.S-MVpf=hK蹜=j|ayYD){'QM\7.ٚ*9[ H3M")'sW|hg3Ը[9<Ŕ

<clx&w#Ն xc7W@fե23l+g^̩סwъwRX Ǿ{mP>'lgi803x@,Yp|gLqG]4D&D ;6+e`$^vY2 zsה@?SɅ1Zrɚ~|Lnͦ4-.i9~:]fzοf*eHR,\ 3@Ikጨ )a|2aeTpVroR}&V_V|jkt}U":!nؐИZӞHu62q~=N@G)FnNR-i0<Kd\0"OD0ioy1eQxmaC$sI7JcF}-P a`^{kL"ыToq)1c/: }(>$:6P2)\fc硧˳8L! xe- Q3-<$RFcGa%lN^p|̄-"SF۝Bxr;$K׃cS 'Z]JaѹѪYjW#[gp^2C0YUn-!U[3&)zVṮsZoP 8s"~;_'L5y&:ocd(=!3oĖŘ'T;\^{ x߱KB,!I,3vM+4gj `w͋xk#yPv0QsWh>o8 O`WT<)AiD)9RJsu,'W,^Rs>O,4pb%/i37乜ۉLaB졀 vqk=^)hwȚ8Kr44B~rW\.eؑ Y%[ٌzU|kiҹ.2+{q}5rfƊYgKCܴ/ nxWvvC/X1/o}x; dgS`^M/=Kw [q Hi}EyJ Ê67 SN) t? xk2Tn=F30qbaW2^Cp?]=C$HOG/eg\0; f`_[]AKl I_z>սT']% 6A TvdM$j~Zע{@Z#xߍV{ TNLb(|R|H)0!jSH:nZ*b6T VzF&aaXB9OZ>H?`/U"X$'H֫^1Q8)WP>{4Fd^sXZt&%^b9^s%Lz$E+ ٿΪERԥq7UOb8)ʜk&aa):H(K?_:1i  x3- *mZg Q-eP,vl[LƒHw~gɯTZx1*23{G]mDd uFS=q{R@ agn>i\eEjUx{8갗y娍Q]'J|; _S1,*ˉg_-LCӏAuI1'/, ^Fqsa;%w$4edJ05# $SNf7ӟ0{Lju 92m4,x$zZ9m76?Nwuׄ)N#d.4^FP9mtDb4k1mS4crɇ+#:y[{+rUg3hiьDn0`Ļضmh"VҢs\-FWל>j];.a@rce޳4;JI'!N@dhە>cnSl5U?'K ym.Qd΢['2Yۓ+j\vYDyҮ,]K駱 #`!ݪ1d߅F?R bzC%oֿ[i5roGi}f)XV=Ot;x,Rc;1P˾г,q*}ZS72OS'0azdG!6XB|58+-c??,+Bp⑋aʋ='?NQfc$2OE=%I;68QjE╼k^$pQ}q\Y:!AR2*$s7pO`¢ 4Ri_&kD7u<3C\|~X 9xQxu6Չbp[td5};!1]1*MI^|$H*Ke}mm`6}\&BiO0u ?^D&$?·zFFEY{8H%t }̵ #f\ jtҙej 䰫ƬFht|_C &JVYu~"=pň<-N#@/ծj@ۿO_B-C:CxzCNHFR#"ϙhfcw[`<=~?jB#̵D\ _PH$G^2cb 7ժG T </z Շh2o̎I>=y|yDʙlxB=Y6t|mh c}t7E 9z K(8N/QDfS^  lF&y#鐥OT#ǴSH#r;&d lK'X L!.!9'!phz/5ԭ p1UrU;X{OGYz?Oq!]DɊ(x7yzh@M(@1ӜbX؄vxik䈡hc Ip,|3İ*{A\ʝO 4U @y9~71c1"27c2z(a(xMyf=QGit8 ~"ft] /y9Z^t;8wv$y*0pKM"#VE! jƛ~'L;+z3!#0k@*PĐ@2aP)k+Gr* * :'&݄ힳu)T%JR*\1X]׫8̼Oi,VUUFo#u8[GٰfXe-0y Qexvʧ@ U.KMKRS ;!zeTa| *v`Ɨ 67N^Gj Gh/w(!sV2 UR꧁tBADs5rA<?G3܂+oCw-s1.~<)i.>ֺ~/kȯ^C[Krؘm" `+l4$##+j4 6橌ʓ&/:fCD.LOR6ZoѐHm[2 k`sӁ/xoOzj| H]<,r*!Sa4S\#ݕIݠ.IfKvX,1sdʹGSrmcJ$wݵ9"Ebw3eYu0P/Nr~f{Pw>!wӧ?܈6ój[׻F )o`ao}t#4/ 7y8g#=Kx@1Yyh/]oΝ 0J_*&+@Y1ц,0 3x3EBסR꧑¹CU,RB 'o3-Jdi\P+bu Q7.g0skgidweqʟH =vIKFŬa6K%Gj4Ym޽Ъ_iquKfKWǺo@v-%?It2LŸO3>)n]B.'{%GC=+[[.woʏѶNp҈vTFZc@e;5V)Ęh!c e8*GE1& 0D4(%lQoYElP?hKXyܖR 0daM5'R.'0}zG6%KCl dr5ߢ\wFm/b$'e(c`FSsJpB&uL2@M< [b9gL"xPЁ0]>ܙ?hYk{?C a3$+Hx8tep:2ˁOJ R |e[^X `.͢'&Bq|Iǿ)h(ߝaxx2ոߣlt WcrxlzqKaP771i:QW gxxax\uӗ5|x,4uZ"?&a@Wk59D9)-f?=Zl3 SΎA8"?6 $X g"{~:Ӝ?~@n,,>rw߬,7|X]~;M@DᥑǾkn [R(|CZFee%d&MI#c;r"O%rYsz}p,X:$DbY*[-NpTId11vŵnYo)]#LE2/EhdT__V#/A8 aop ZYj`j:UpL#Y;ʼnyb68T|JRbPd&U!d )様n:瑑FbwyeӤD&XeM9)1(PY8q a .)R1mEc -Z'v(sOQ ?+ٲK0yJ%LD{'[fՋw"IW@G,)ޞpJdxؽ<xIF[%WBV7n;Q4Q8~h9r`ifvYGܼYf -ߊݬ"=M."U`Ir~&<ߜ&(SB1bJ7!qD;/K0q:JGž .`KkL˛SZ Ʀmkp1?,Bn&򼐝sBti9q []C˟#=1f :f[_yڅَ $ p\iљa$"=֔d7T$OABk0 -'QM*>eF׸ k`~xyiƕ* ir+6W`o9 ]`*;<"1kUi՘pD^ tΛB+B++T)`ϨUmF31 a7 #trsCU)CIU}99LnE|lwwo~u fհJk}bs( @=C+*8q#Md/jщN M T XGD0œ$$M>7;So=`G%c 61~$#Sr"b5>P_,~y0<#n}4Hp, aށI`DN7%t@=[ôo*1>-xkQS~=Q3*$)#/scqXZ^sej$c8܈tfӾd̹%ӓ v`*e%:]͂s_<+ypV5 C`=¿@ /z en5JQdt^_9kfjW\ikёGUf:4[T} "cJ|QE豠\. օts\z`v R2oي8/SfcaO  '0cnw)(㻤jW[l "~m0DBaޠȔEcv%Y WۮtT(dҬѝĀ+8I+R%o^k,}{HbEmRofkKM}Og"C0"Rj凜3W Ac;OR)eFG"iqXߙvspRD0W<w@Pv0X|rN<m-@Zރ@D9oY?H `W$ɥRc.9Zjc2!B6l 5j$R@$N:%bp^0BpccoKJ4 EC%x|y1Av1fR|!t%^ba-14fAp [ 7}?^M5ՍlQ</-R.i{N9cX*n08i? g8 sP~{jmS8r;pBʞ9E^|'i >gqV0^nyr#PpFZ 7;bY5J^0ܨ< "xaO I g"_xFZb͐X{T˝F3/ 0$9 iά+l x<$-w\jż#翟{Hh76MD \TG =mDg;q/C:~9g4E[n 3{n׽*ۚ>]|ϡY1p0vF&' BKE2^ѿ;2cӀ emSba`,"5ӿe5;wOlYsݓ qOi4&nzy:Cc _;a9n|f8JϜ9@!՟(#uj/)˜] BzX0\!Ӈ/`EQTxGcnv׆~0 ˻Hqkf;oUggf<5&">F +jk?snkqy Y%\[C_K,S|ybEWL}/~e#ӧwf?m$ЮRY '{p>A5-wc knw&|?^" j+HYF3~pg0Pf>ѺAK 98jƖv:Fw˓EV􉶇ߣytF+{S8 w@þK˰c'3-;;I|6-w~Skp,@m@޵҈R,hR22ي4C  n@EL;]Lk9$zmcү{G hNw6aֿP%,"b 1B=f"+eɕPSӢpd`ͩG gvjOkWI d/VB=Zgj[O} с͆FԵN@rfk{:Vo{5vQ ,O _pCk=J)IAμ>3D٠ eI30@˜ڙW]I)gh4j:y:[9GPg/@]Kģ&3A~|<[>'zgY>yd7fU(BHn@&p|߈i<cq0d('dfzj9D~wDe }! xA= 5 x "η'l6J͝jH/qZB΀8Pk/${mbF;[ԉ7w OjP^M39KՖ;hSB S].Y2da @ࣱR_>9-R.哭˿a{Cv˻ ףl-y ؆c>ABMpa!wr^p] 9,zDs (8S)BK odvqzGT=\/ (ոk[W :Uv7 1wJĽǁ/O?U0ex 5Ó kfnc/@U8&:RE2(S?(_WWArTMlP4JoW:LimwН#X(F ( t[OAL0e"_BG@F`]/"-IC(ySdwljIzm#D 50٥-4KMAo 2$HV(v&|գ'DQ)&@d +Ct;vJ{{[DqW{ADSk(쒤}D'<QYL-!K=)e4bvn[bNYWLolu-Rݏ׮ZHYФӨ9v`tA5W[K*!-b_lw8whؕq 67Hgkx&wIA$5}h`!5Xc!6!s&-| 3p,)CWKj +cQ;i=&m*u֜,Me-IQFbZmtX/x,5G.ws$<`$kya[[LG6ȷVA""PḏMwlumM  cjDs5Y|L;# ^O[̄gb'aG2駊IGdҟn?.]<&9%ع*il_:=`AzLD щd87׼PS0`g cu!#mS{Z?oSx@!0.}*yKZlS@jND! 8pzG$C{Dg1^y"!59GD_~˟ΠѪ\  (tL']<$tqyσ_z| |slǠ@ VGUW8S0Y`M{4T@&hYd룧]W7 ҜJ'[[D3>U:=sU 4x&$1<+cXNU\if}UaٗNCp93.ʸ<OY9ʒn%E)m(X[\A>%9V)W|0ff+`,TW?ۣT(7_Fq9-'P70mɸvfsڷzςK9 :FSyD*HY:u= 'sFv([%Y.Ds Х~K0ٻnCND? 5170IKe9p7l=_ɀb%{L_]ʝ=Deۊ,GmewSxwqSEG8ygsm$asMp yDfzBLkl霜SScTq1;zVEC/jĽf#L|%SUj%)KY2v?ZuKtfN^=4\rԴ(f Gz̡66?{+=,I$mϤ5<&b !˻g|P4)c4_MٕM>*:(ev74aRS$ dPޖdKdT!BIAܫ\9@y~=HK}n{>rqӔ!6>juIV9<`ܳqG1t2YI hd:U+mjF|@|-oLDǾ1ut}3ыljL~ͅXZ& |i U Y<9#(NL,B#V Y[va@&RPf"`@7>K)Ȟ,uMhevG!1LL,b3"mE?S\V,$_xH_h/ΈNMUNZ4\Y|@_ di& # sk[eAMl(Ȁ{@Q"1ieuߌaWlSJ 䨷>:ܲWo7 m=Rxg0~3KChԐ7\8ߠ"d?tG,}acC@h_7oi/.{CΠ-qoZgώz1J;+5k="h6VxE1ȖE=l$F߹V`WIG1}3}}L0Y;`4>:!z4G4`Vq܀. #Yy[\<~Mm7B Efʦ s)6"Q%h["<9/[ЁMeDG(bMdɂ<„$dM/0H<Uجm}3L],Fl XWdPQn9ڦ'U-_y{D9#\?BEKa΁b]E4,<$zl49/`Y ,9)L5S9M*S4z87Ǣ5L-jGY1i Q` )oے+j8i5vk35֗k/ R%^ ԗ27=1TW²oJԎd2f rL6)8[|Ű3aHu^a6f'R2{y=.OD-n16>jbg0<_ڑD{FV#<_`}De2fGsBOεoi1%W ~ { es{n>3C;y_^ X%ˆ'#r mː 3 @9ny9kNOѣdǤ^?}vk?xWϕ.=mR3հߦr_ >p59~ul"Nؐ^\k =u`MC%[}wDHpX%lŭnB/Xi T鏧wu ;SulU{~I Z4ٰ,tQ> I e=S2(TC!z}i|BY|Ka"tS.{{wJ:F!}:őkM^ -w%$NmjRRܮ:@xV7$dY{wx@ѽϚg# HT;^ s%BcHFz;!HK,4 4/maWeyt+`Kkm`xKiڃwa/G -K Z@M8;Y :_(9XQ eFi^Z-O]Bgc)eOfs"W2< 0nсPKņ" A#E+85DA4i]}ˋ퉨9:i57KBMp*sN:p&tyȅ auzG()Kņ퐮[VQJSx|G~\24Īa}/ &Gv;LL $K>'.kN,InE8ҞȥE. ' pǶh21֬A;8=Bι@.;YHHf 3`e7!^&&.D'\&t #ԤA^A JJOk6R\ RT:Nk'uhyz>u_fĝzpSU(vi1̳}elBTzOM@ Q9mF/1tuW0ˍD3$aF>7Ҟ / ܱBtG6 2/" a ?Kk>WH$C&Ggy,rܗЌ7WJySsg[IuZpW \竪?SVٹ>`0"MB,w]C|=]$Q=䀣Mǒٳkq2qyt~o߭GNVԍh4u xҔkgzqqA'fzol?("uhnO+JTTV#Bp0'e#P0 3F?no ,kI"^'uӁ^_4uZl`X@_U'`f}P n.& " bz"؅ B*Њ<%LڥqLa-dȦSY>{JLSG}ҏQ-$_~Nq*8`sLzPe vpj&}zh.NDn;1N@|J@ts"8JR4_˯Mr;{I. Ptj+8%Jޝ7ma[f:߃'Ֆ|P'*y6t*%m[BS(1]Ϯ"œƐqֲ{{hB++5.SwݝAhh!}>Cj8wY{Ԍ::e5pXՈyc/Ζnnˢpkr-~_hs!0F7aqjiQP#R~٧I*ȞX(0Ȋ Ǫ΀^Y:bt+Y] X´)Zq2wy?H˛c_uVUѝ6fI#Dl?- x$SSܝ?70E0=r蒤dr;/qJS=x@^@ZtքY^?PkԆ72Ч_$DtCs^fL ttNڂ|斳YFpPL!\JaUV2j+;D1p ROZL$4Y vMyh@PDBÆ8+P1[6&y7_nX d/(sDc]ƈC[߶?]LKJt53*[s"{X3Z hV&ȕ w#ge\e@B扟ؙY!S$`Z zs+n.M7J˔ CvGi1+h:ǐ#F7mCuσS][D\ 3w3Gt8^\*X՜ z"φ9?wa섍 {\;j(Dee#q-3ggɒ٬V|Pl{c걜 C,~Kl떏d P*;ldWZpeIL*'P ⲉ'ɕxeR*!R4$B#O"j" %bugg[iɭ+Kj$;ߴ)xz9 nP/d6IƠd C iXt"[C|Q2R`p*Bw8ޛvF ʮB &#h&Q&^^ +E޺hҙN6e2rʑoaZ:9hRo dҙH +1ޭęx=Zij(+x(VRgPѕdkߺnV834q݌b'A{HHIOIUýX68qB/S_e7uTFIy)hœ*m;@ۛh8;Cj>GlWWUa+(~OH1IǘHQDL,)-/ tɁt8dbv) kB"a=}\*S)vhi F䲲 "8*ݙݼ! QAs9x*.NBhLɑ'$'u 2˨Ue-.~6\tޟxs_ޕ"#?b#𥩮3գ2u8ESf=WIPLrDEVRI6 oЬxOh=?' & Qjn!B=9!C1*3}ɂ֖V63~uHM=5n* z9Qм0D.]r`ȭ;鿭2Sg6 ˈl %vK:k %$4\[ yiREmֺؿ#׾8[TDL!̔[9o uRְzYaz KV~|?E!CC{>S\w>Ÿ#&Uv`N6˜>HaNHwlH3'*mo{([4tܚ$7fB_Gv"CK9[xH~zSVg@U!]aȝy:KDQE͢6>-肽rj\8=o+Ȓh8I>2㬡P}8K7I^vLԋlFf\`ڞq, N[ '/'B@P]=!y>/OR>^{2 gU+. Y_%o!k]٧"_aҥ`HKˠY=-&/giC߰fuJ/{^c+}JX'9#ǥZXXxTfPvJWoUaq'|_7il=I/VO;$m Э ŚTh2_|o">6Z=\1zJ2hfla+M7˄wZDyJw#֦\j DpDw^ʍŎզ<0bAS%`HYj (iirѻ"cD`? U% ɄuSҲ8T3\y3>rOTKI/M31,/7S \1;! ĪD42%I 1B'Ƙi}W+{#i}c"o/2 rVrJnvQs^"Lst$߾|ˤ k+-A9=MJmey953݋uusϧ-n~,έ^0憇}!yo>뭜]А;*@"$FG2H~7Dޫ$M_Q:k̨:"y3>vyS !lG;ahxVwb~',2)Bd@o Qi7ߛ,Z$ 旵 A13oM$xﯶ=ٳ ؐUcYIݮ=¾[eU^?}ڽ=95v&zhGQcH{O$`ҡŲ`ޔ`pKH D`{-L7*+(v_Pt  M!בle= "ZrIK^>!M#D1\V+:d[, g(ZIDFҤ?{}}@2.+_ncؼpX@WjyW VS*Z cD1hɱ3.h!q>|ge BU\lD܍O?'ys &3t %Rzb5úPҊ阀J,Y<捊^s^ *lG&t .{[(ZTk5Aͮy$R=[xQsI4s:oebJ@lt & bL[whe׋WPoukly_w`!(ح] %Ckzi*C4yE/'@o9! Ȋ|FQ};̝V@Y3^') 6EI<@e9Q2Sgsdmʿ<dTÏmǗZnt\z w?//!.5wi/߲!P_0F6؜5Ccen_F\G],zϱAwv3zV+rdʫ,:$] 0KZ6 pis|Nvl/xc}'6i͈<Ҫ"sȂyD0eaߤh$" rUBЩYO&v9.ʰ{yc~b_|z7M^?LF茅ڊ f93ElArI Bx6?ζ>C \Z Kwd*AG睇?V+^#+%-sq12MH|;$kAe_]r0g'hv%H] ۘŰQ~W!@WnlR{Z|*3L5KxNy RqK]Lɀ9(y&m1RH @(0 -C$W͛Yp~cESu}5ٿ%%Ru%}ݩ4b]K1ܩ~\$ve?xrQ!ōcyqJD,QJa'!12 Jsf)G>,-D憣͖ hy. fKN}X-j3v3KPEŮҎ"hX;#CB6UBTr$zp_L0s[ vвKgxrKcjΆ%iY%4ʨxsVLԸDK+e CcNgj#Բ\aBaQoޘi$_oL46oaC3JiӘqYmU?zz7KМBZ"w/CnD%d{[[\i"M=6՜網c=y=c$~[?J==S',ӺŸ^*qo"}xuKE3C[3z gr?;h !ȷ`w#ohA xckU3 GK,*s>>l×& !of=?|Z+O屪!̈́v_M'C8v 71 &ɃkKּYix3sRyϞQM92˟wd*/SgƧZWNcCn9/)%`?İwvE:"AJg +ۿ7$?Owƭ.ݛv2+Q ΛW 5ubY)0O8q;Ijfk>,򢀩7RR-˺H=<8>;oUe $oWwr%Z _VوңۣSg$&!@9| ʱ!o[h%gLjXL'2՜e__+7j{AXZQUߠl|KV%q́91Hc~(ba9DXvS/=A .qwGk>a-/vokɢߺ`+;g Ҟ%l|<lqT6A?XA īFQaYAW/3ыNmtJBXi&R块WaӼ!**e!}b-}σۺuzN>ٺlfK'Js.(Z?%iڟcħkSu1+֮ AbKAq}!'(^gD!P; jdiUۉ|,!S`I#緭l%MVщ.\Yqv]C,`E|(:P.6c<;Z9v:JfDt(З%&n9,'D"N(ViڅVKyTեO+js&gU*@i1`D )Pѥ>%i9GHv~j!Mg@o~$ Yhx~'9+{sMN{i$U8ֱݕ@]3ܭK֔{j"OubLV^GLH_s1eQ0-lm+9ŁWat'X܅uey`(l?Gyf=gpkbIp "k.痚O*5*EWg7uƎ8k:Zzzs(GW(ax'M?\&>t#5.XY P6Qq _}a cV.b,7!# M2"9H|_gXD8CDMٓ\jE(4~QȇI:yT}Z?f[%$Rn5s}57ׂ@\%[VQ)]Dž7,&ȚMtBX"*ȶ> K"m^&K{gFVvi9ϧJiЮـY@4R ]@omL,XgYX_|zx[A{h|XK&~ϢjCFG{5!}6bЧWo]K.jQgno̭Ƃ+~AsQM/SpjZC|…g>WЍ)|،x "$-5p2jmC1g@ݼRV1n%aڜli5-1asOZ+ջu9F@{diETGG몲j1G[?l%AgO2S q.6W"ab嫧aS eWF( W5O$IiaXQ:>h^jBjQNAj{D}hΊIeG/%end&D_TbBWKծ1AŔ`fؙ(~[2`h¦:(ҚWn y{kً1 eH7^+dtA`2I+jcҬ,X _ X^WC7ZV}ދ*Ơ'+?W\esX[uNgGXCdX~ +Ƒ{`A ih/@} fK`jf'*}-2e!xi@x0kC,"ϸ+ളEFtkqHbaO0| >3 ^2ڜc$Pl @' X>He]/O}\ e+-FG/z&B1&}Ŧy7[bzvЗ6RK"tq,%mcSD$=jp^ilKc:azܡǡdt$e*Qj>טjF\BHsL?B}̦ #d9\.^$~iV؎x,ms5qTJL !q1(X#c=/\揗p^(GAҭDL?/P=~m$U8Xgv& \i\"\azGPb++.%b_ R%`e/r?-w-Aӧ2Lo~% , Mq6ffU#0E; n`,j@66Fd+S-i/#HJM,Q y򺂌xl& 6="'9yKO\hX*~o0sG!ֵP{8AdFF#0 ,w9{=92\8T`D<{aAvm<2z? ?}ط}Y-T:6C ՠ%:(\O}=6ۻS@{3} =ew֊H;, tkJJcҋJ7 G,1&vgO{<\pt\^ULrфӣFNtw"6$#1xIM)xa|\"2D"0kc 7ҦA (+b2g5'nD}(ayO_HJ;ZKk1oGFve,]K`2p,  E?|34ycNy "Jy?T8 -$`'~ŕhK@.oWB:8qՅTx 3ȻЗ[nOFotŮVܻX2yl>uv1#|6{o6m>T_| 3M6VT+QlN [s+wNZ9ל1)3w+7ߙ;dXIЊMzI72F8``ɈlHӇ.R2 5 13@6"A xUym"jHHPHm5O{9EZ=RvP* <ɏ=4Ad_6cOYÎP7Ø| Ng0e$NV |qeT2Hh!#LɧM/+y>0qroh*rd1X1#A }: i&):LEcnpȇ4rޛay:lR-Ap@Jf@OL$9moaǰ)R9tMkY?j v Ɉ x`k&6˟XcсH õ+WcUMH}I98RncC 8pbTQ"*|WLvÆsf#S-P%9 (`ԻlRkԫZ8^DʤB|0jrKYh:huo@Zm}%YciL'#*ip6@f}F]+o8<*Ɯ8>RRCq?1EӓJ6- `+!n.4RRa5o[RY̊>ƶ"1;[hm_(Eg9Dk6q )g#q'A% F74۽u 6pXEp.c:osk[ jg(Q!;;Fa ^"=!mˤ9ԏw#;(lKXE7KAQy?YHSv*Ụ0&<]Xo )F7\.gnﾓlm/#RH~q +zy<|?~QȒ"qab޿yJ9ta[3w0|glesr]ø C3;]y)H %OW,b3 ̯ :ZsoZ^mR=RE>$d$v*9)nH+/F,b-B&aڍp^ǿZ5W:hV T!]&/w"ԘƘhcwNn6@UW&r#fUL ՟4|z6l#nUȫz6X@r%:u$$/O;=ڞOrӤfBw|;海 r]iįReT[ ^*5[X J͸ ǣ9{$j5B| ||oMu7!)Ұx'cSJ7?-'ej]ZaT ~.ӏCܒ/nJC`$lvAE3I զ`G Q%W GR0I')[%h&D ΛjcH\mi?KflW%ip29۩3DxCqhK2u,$n ]fs[<pu2egܽllIv{^[JvWa%yԂa[$ޓW8?M)9269U0R|\즃pP[Ǝ[.8\+,e/4Q׾!P̧dY[[ |xTZ;y18|4 +?zKGZ}2VEb- (Cr4˘@!@"6Bb"ҁ@%dU*  HRE' V,Vywv \F [w]@3ؤ)m,\C۵2&8ei"6;dgBPx 6slzι9nι7~?]032:Mܩ#rcb<)c|.DP#gӼ൷(Z>߿js$d`LIeԊLgϑJm^2ú!XSk9#{x% *QCoG1oB?o9u~'y[ZRAyOP9*G@߮؀ I1ȭv3w7#$gIUe b*wdyi|RTg9iCբ̗/Cqij(!VM)D'{T5ʚ1,q>yANaG4F~cL]H;d!Ӟ`k7zTsJ*TL|NZz8ZY ٴ\]0m:&Pؓp1Mt|^xmA!yHt ]QvtZKޞZ+m2I:̼!Wi'!.s|PPLAG öB^Ѿ +ucFIwY~FjxBh(;yGWim{ U#3WE[ Hl&59t>UJ:dFۺ!cO+3N(MUJV } 2i)$2RŧQ/cRY".iO*Л[_P#4c޿b*츿$ppaiS6~iݿ[!U ^luq\i^7.nsx+"K HmIZ< yؙ5.J*&SOi=ـ?Q[ k$\O=w}<9(15[7eD\S V!^{K%szĻxn1z/1|ISB8~ME 摊eZiTMNIODOnE+&,9TW9pVwmZ[>pjPE-JÅ=u04]TgEwL+5z-C>-L1P7,ӜOrzijI(hf`Sug}.߃-Џmo 7ITACNXѵ* 9qȬZ*wU(l!3Ha@i[BďǍXM %.UwdUoKY؟E-;W+ \Fsժ}{I,V(IiBΰwo|< mf|z)u,F0I fu/LE3V#HQR`1g ӳhW~rw&E7R{:TLGҕ_,l)D{8BHL tf2i8naDI>]G_d[i'Z* X&;u'NJ?qp\s %.)z?qPIrJg<8֘Ea+ 0k2yx[_ 1gL"֣o6T!-y`b$Pl6/YԛB"{oQ?mrO<8y Pfυ7dsf1_*t?| zhh:3yxR( J(ԥ-m7" L벹>ʪ[j=G{%ƢC}/Q$$N-ߙ[^&@} fVXmP. 4c0WtDQ;Ϫ+'(6Z6jw1GэUL*lQ™/$0zAiSrKV[ƕ'^ ].~07p2c#s!J5 W;HB;mE6IC{{%6(CĤ|B-ٰa J5>{%zՌe k.3?{%+U?Irʩa-*%fEZN,jAnMބj6dE;Rk\98r9{#䘾 ӒYZ~e] ̶ux֐g4bu#ҙ6qĂPr?u\CqCO6KŐE^}'H\p^.T&@߀k-Ѹ^BPbzUs$3}eٯ5scMB"3}ۛ(t+"a6zPVbMeLą:ڊhz<|>|XP6N`&ƒGuT`Q\O&ȶGhnvf\k;CO+yRٺLXW bӍZnR.8w6X)kp+K\?(%Yr|t#u욹ưzk C*8$"Iش!/""|o^ ߚ1i}De% 84[%I<Z뺵cUYUKjoyvCITX6qԠ%C$?l ʦ]^+gg#Ԉ08\朣xfE kV d㳙m,M=Fm>4L Y<&PS!jL3@Q6Kg hNGRYֻKH,oc[?dRs6bR|$G9\MvA*JYZaQ2DHޚjܫ*D* s?61R/SdnqӣlBԛ5WlةeNd<>0$KʛU9=ZҟSa[`%o:2<v˨"Ztk[hsw69L>6/DŽ%~}/4crkȍua [CG8muƻ>@Oq^j@ͰBP8Aq&mUQ G&{EkmIvD 0hն؍]x!|~Fk\NF8R DMYniuZw;S76@ D{{<KUҲ0'~"r^S>A+= t3t,v[gdSG/gHK J$l/suvlnHuiC1}5Zq ez45i3`}8+4z4^вYzxMi:T "M4?&G$'ᆅJU#%G툘Q H<e\{괄`4g[#{$7"o~ fbh%~#Ao"LEg(&6t⎛RdxCպ; \ ŬB&I\2똬bұOQ-mѡz v~F1AY̴qJΪTIF7vcܷC"=TQƂIh+s1.Z+YOw.\cu)=/>bqzP~|JL+7ÒAvm*joJd] oi-JQ<(u%b]=@mQ-:8NI.^16A|"׹6be:O˘ QT5KS/o4l\Nxxz $_I)Kdyk=w)b7R>PQuU>/䶮he!x82B cOW{AyJ.TU/Tt|+2]KPTov?r0c tc qF`0Vr X;Lac޳ <'L뼪n'T3^ @,e Wr f Uo G`BFS"/|P܃Zj\qL-{"K&=~\lqd&N@tz p i **r"25'oH7"p|'CÄIR 9Tr$?RC";%M{DdǷq Rx iկS j”6,b!ѥ9QƂq}TE$22D+lnvK;$nj|ܞڔwc@XA^dw 6 E$lmUFѶFQIsDw@YM 2NP=3zowxnTB TQoU_<6_ p~.+6(Kt|vgO4Q[7_VK/a¡k-N4r4*P:I!ESހZ 2uw4BO7~ky<6ǰ !._z#9n. b8x/~sܩ(ߩĞvL:'}BN J rmVsTy4F#܅^~41ݽ[=bG)`XǢً?%\RKzaμT"&xճD'B/}3fX x32HRgEQB߉%d*zvIQ.]^V̤櫐 O ]TzDʡ$ngVLm/ n?*e[)h2Ƥ 4{'B5ҟ_G)ҷFVxIH E*%x  ݝ,ŷ$ѰZe:Uh-'ƅm%Q؅i^3Ug[f_tӯS~t>A|_ ʚ8,ՔOUPNOPii7`d}!?{ PVkSϿ7_ڲpt;n(Έ~p)iJ.eBVZZDK.3RJ 46z@. =pR^*o2DZTp#}*)e6shT23G0ڈ4hco>E;^@EH% ЖЖ:[] vQ$E5/}8pU+vrDt<7G'7.S# /YC׭H _([5jrVo͡`q8SgO%2`Bτ.Ӂf{X,s'ӏ9%IF{m M&i?цpUpP_{K@ҡ7[v d]qfQuɡPQ~.MZ c{HvMw\JXi̖ŧ@Z˷ QgvAͼOqÊ=v>lL/GL.Ό5ۖHW9;; =#),N{C 5 MI~(76) ) U2aQ)-%]hO+c+&5`^?B2%K.@`yF{Ԓm+T'h}Aztp l44Cd$] 0y|"Eg˗5NFӖ[gyv&O2'ݓ$bˆOc[e yp T@MlrkK#5B)lS*+Ɵ'I* Bv7+[|p>*: Pׁ=歃S7)2Y#i(\8u_|T/Y1W5hܵ>G\ʽ&8]/yV^ F kxK;!!l"għ.OXJfߨ/2`_n t Z(q8R[. Gl9dꙟzӕ~FpCd \C*K`S˗EQxZcSrrЈWz~hm)?! \*<, K;:) _Ұ\`LP9%4 )~.vRc|E#,;yn} xg,yͱ pCP)otjmDrH7>rtHj%<H̦ۘ 2*Ե];,d1=rp3%BEzUyYhmdZKˊY2 K^O$圷Z<1 w\6o4h"n\NJ7"f-  !3Y1Z30SUx1*Ire ̣w<h20eK}r&ǚpd#'0# Q9ru?mKm,3@9(PXO=C ?Z#@ w0sI1}ԝzXrγZ(C4IhOt(8 ۃb⍡g}"3zZ/0Ɓ5gdY ?#=V;C9X<5w?g ;!G V8|k{90E#al8U$eZd.ʚڻ̳Ua8*HT>&Lqؗ61lvOQ9/GBB4/ؽ 8lP[50/e.U+mfl%~1;4I%UY9 G%Sp[zq%7 R`s9lnp̥lCld5wrz?@zW~>`l%trUU>5_z tJXeQM!}UF;'ZsiI[7Fb(Nc {U 9[|d,ڹ*#DWs-pௗIl "@qF1A\VP\BZbB^ibJr0Dۦx Qb_RON 6LS?3NHRܨ6JQߟ촐a}rT[7b M7WFQ_غX$ :?f~ιkVپ/"4Q|*+No_'~hE0EMo;N \='ruB6?\Tge2"PI:KFH 3ȂBVuұ(]fU?9X4 R|\9Ե-kI ,gLQnf8Z+LNJBOi1yeKv9*#LE<&~&NfNdȠv"^ğ~">|f8k3A~v=tPY4+ÊȑHOR![ʏ3Lt S[,N2 /_m=|{b)Uꤜ }/B tf=ދi1 Ik]5exj )qfHI g %RlW aT. 06YV:1o#b5"=ޫ fiC 45gp5"\q,ɵ@8s߿)lܿl[<|diPM?uWJd8Ac, 3 ww粨ڗA27rBP#/!hvCbtn{JQy/~՘ d8Ep m"ꐽ]TQ!m٦tYTNos e΍-6G ۄ׈ nM'W w9Mx齨 x۟挭ƥ֫*P&aݳkl l_ч2y~ {X+c ꀁVqJ)8?Tr9n~DTΞ F8`Oi<atU+.2%"Gûjj_ʈDx(KlxDRX[w<ݒkn`xY$ );"#3s[dX"+ R?VBHŢ@ $omԏoĢҠo`*5[OcջڊzqhNw)9%@o֐_?`λm"xDBI=sXI ʱz۰gRB{'r Aap yWK׎U=RP|"fAh2ηZ'ŝ<)Ot0P @=4`(1bhYeVFF'yvXX*+@-TgtK9 pl;678o[Ʈ] <3 lfZ} {b*+ \IS}[E;D[0s%ɵWJ -Ja3h ˛p P؆P_LvN$&%sV5LXɧ hS{۾+>4vقY "]/e6ٻ k- #ΕmF_Ɇj.JZqWsj1RpA94Rê { ?76q&!Xȧ7Qav)&"id+39<ۃU 0LVs>uz~ Yh)yW-{[XT͖O"&f9oC4rE t|^qB-ƎVo9 e,ѯ'F@".1ɰQIǖ8xnK[N 2@@e*] 9Wcu8gFxgU8 o>a!Ղ3؈ O j]h/z+ܟZs&0 pP`%F C(Y6E/z8-Q¸C6*-O6L([>7[w~ҵu{‘\Z6oAV[7w Ep8['$S*H@ Wh`#KG]ON!ao@6κ\eu0zNcy'LGE;8/PN#R? 5bK@VN܌<~9W#%+M9 a3?gp۰$*VXج},B R {hZEձj>ba3QTf.x>nR\_߻HN`>'*w lA_C7akXef ?Yp ,"l@cN?)P+]%̜Mz&s)иO IنEWCYBp%FF[Oaru=\Ma!K>/k%WJ-`R D|~ڪ S=;8wuh) ਿ~~|ڧZv E'EJ?^T$ bлD^Y7ܽJЇC7Sz~3<ކ"-שPSCFpkil{TM!Šδ_: OX|98nJ'}JzF#\\Q5uDX2q4I.6>TyVQ7^J9F[ke@zgƽ)al^E VV!C@ f3x۷&48v+},>jl·L|'57Bbo[FG! 9:P#cyH 3Ѭu)D↭$K:ȡhN5%tI5.mJxR-St"䆾NEXg$ٻpbJ/onAFXnMrOm8CdOboQRA94: pM1\,a׬hT7{<(\f #8``hn@Lnj&]s9ŤwйFydЫ8 yecnH7$wN?=&\zH,ёIzuy' ;X. VXB@>Gzu/}d=Dl >]<,ȘI*q׺[,M5$H֓340A)=.BA٫ H ֤ҳ g288' qR'~GR= \uH6mVHՋ"KE`)G٘fDp('\ş&|lN%j[u q(k:ļ<7-#Č -de8)h&<(%խ.W I܀a5HzkQ=zi К,̳,AˉZu)+i7,Uy@iUjIw ᳲ n)EImUD'?7DvY S, Vf6km);kbFMA?k٘kВ RQO5_vA W,ޡҭ%ۣw< T1cFEy` Y!ڇ6.+FunxjE|mk5rQ okk|O2hX(hTlp7A2 X?LZ` '_+H$ս/<}VH|Awf 2v[Sjz% $ڄm[!qs[M Nj9CgwU,sM)Yyi @WBNB(3,˱G"/ nۚHqhү^.VXJ`ygihLO+05Ze试tE޾IcۅQ U6VcrH)]Ek1\*ufkl8]E3 A\>,zԊx>ؘV:"H4,Ps$a[_lYd0:xcLyoGrfo8O!;>&qDO6@[yc*c=H!'Y{z8&C0C XZfo=ce46 l9w-V*pbO pMFNWnJ˧ErFݙ럽g'S蚠)N]D@KR'|-}U^bm`g=4]ύ\`A &ARPU²h7 ϭ.=1 #I_*ncNZ `_h*ӧl\LT%p.l&2u{-YNNpXqid>\ݑ\e wTˌ^6cyp)ک4`1 зMc¢5;ŊQފPTcX" >U@?;nQ8m:#Hdt~(WFg DZּ7<+Ӹ j¨{ ^h 7,cL4fú8q ᶨCᔺ$A; uK)yCb( mi"5 )2X)1"3D"2_?v9e^?}ߑ ߉%Sc/L쩳 L(su8VOgp)Rh 1/pS݈)އ = ~+.tJ^BvTXi%+7))p$JZKLP?J*? EO%sȄ V}p$a5ݾh8e#x<#E[TmNtN i{ndel$x_ͩ=Ɯ!Fv˫ydz)CRFH[h$]ZakBSi]]ā(Q< %e<[Dr<8oPqњpwގIcedSʆtxJuy> `3dpddO0ۖmlb8 G^}ʏ*甑wstż" 8_ /N|PrX*[O 2-_\Ě-hpO>2xU eYeKjT:g'}(@$%\ep$m# ieH(`n!鐫lڼfl Lbsnm$î_744( u{eف, .P+!`tFϿw+ y`MzR1yc?vF&d$Tt=票9f[$ywntUT}mS#6D)Y#ktFRkIl^ڍBys3AFaӤ90Eɺ3pG ݒz0ҕZ{6Sr(P 0jqԂq Y)[1r (0ԪmZx0I3gI=xYߟZ $9O@ZS|rTw4GN2:l];/$s0P:FRGRp K?D`& ]e%U/`?aV0z r󤚾I3>– iVK(S]zx.t5i$]y!8`xY؏Z(I+0t!b 3P>) ;[Ekй71$CgV9SvSTƛ?YQ_W Exe)C C70aB)U_%>`f4bRR+w*5CEET-tSАOoԫRTr=l{sd﮺ekTk#GR:0=3_J+]%/nh=!!phI~_frwZn+ydmS2n.q&|lߜ hhhVU 5welu8uyi_5hΦ.ZJ^Ca3χ$M>C\*7dSjb)UHg^^ׅ\* F$|Z=Pl6aAQ+Ơ| ʛrŭ4Z޾[ruăQv[◖ăuTc^:aRA l05xt!K>1kL0"~]n g"!󙶧nR:[hVIE,BĤ23 Mlwd_0%opx)~^W^C2{:&%j>NfQ00IYq`:s%rWu;C]~6fLe=g䠃.EFZxF6S끈(D|,*d%Q}2!U 7؛g'"g Uui; K%^fK';l#B \J)(MA>g1|^K-[ y0y@Mos^h o͓=j4h H'*LXvpܣվ5eԏAhI9'8cx4e7@ʢ&'Zb_z(Bp-  E.Gs8fzơOLH} >~}@=毐s(Źo,WW19wӌI5*lvK. 6Ա2o2Au>l[Ebb1.9Ytn$72GE>oLZIF@Цp^d6Oы{.3 ^X ' s[uyc.&0 BRa7 ̶On]{lE]Yyy(Ed"ʓXL7Oŀee"rfT?.'] ƹp/aO Ҵԕ`w'mYYBzQplsV[O>yҤ) y$^haY;Uj*̇k/\ö?/,su}i]%>9{q2kX\'гAʼ3fm6s=b;ʮo|I|=Ŏa`GMC9ƴmۥߖm+b$\%." cu>2)+Q0*a&my=1P躐0T!K gJ1V#E Vdx177KCUr_&:[/h23(. ՛``KVU U>RcNdKd5Kځ6-͢ z r27n\=$◲KvNCjBpb/T߼3 [Y 넄 f*7Xm3iBRmoQ_bSx s'\pGaqDXʝV ђR3M.)>_Y1kSw\ID.Sb%V)͐ߵfks@.Sf%帍gR{d"DJ7fTAJ]̸#Dk.*Hj }q{l<̱簁3Ф?KHb K^ٖ;JDL:].σi~4ty-j ~Խj  C h GQy̙~]^O 3U>_ުNh KR*cDeL.291ec{wph*drQ_\İ$csm1̵n&E TcLb =~+sh~ H5Ng{Tg{~R֤F;?"†] j 8>LTN+ؕPvRaS20\nޯ7Q@aTb԰@q|A*.YNi:zGV~mDŽz rF[@ZkQm:]^uBZՅߌLs&NI] {6L$-;VP=*౭,:S e?O+OgN!$lk(dB7}cR͕HL'ԵD+w<%Z6tT{K&(ddpW$\x"Q:C+-`~|9ꡟF9vkɔa5艕_}=1R6ı3[=\~FE+iFYxy+wH?Ŭ&=b=9cFgwm>Lx_"7QEE& ]кRոY67e)' kܪWЗCt-彌iP]bHw} 27lQ UsblxGbqeZ(UP(\}?\s2!NtS8i`RRs{p5zlPݫ +WyY:L lm$mV>[^y^ =IKApSO/>F]n~lYnƦA'Wh+6$mQZK&2S$I:M07kZK7Tla8Ẁޞ8OTYӂ,5 (4;껗h6|):Wd/ Rn@O[ 5kvwxOK>z;~́ @q6/#l)JҘ:1IR邖MRW9|ǒ"άw?GǚC)q;{2Txy9oк}a@)=*aMQMOnhr@)'>p-Ŷ~VG WOL20j0VUQרɸ#J3ng#Zd;mPul9yS|ZtovQjN"濫^f?TwUEy w!6i Els_c}+B^@n19 yT>W ^CԄq/d8gPTR O#;0.bf~A({D713>=ݓNJVAkgxh+=I+z=2ʵORu1 $xՋ2_ߛVK xV:QNJKkQPD׀o?.r +ti`Un0\~˒0?51ijڷLRo{"S\/w7Ud~,FC e!\ ]`le|Ǩ 7Ov^sR4d M='s q tr15F*4Be*A-8_`1&7ܯ#OSg;K$(Qѯ(g8tA dK2WUS=xyL$Nh}Z8;VX5II;/k Ãt  Nedo]8 +I^ë \u ^_:wz&/yw3:eZ'O .Hʄ{E^}>w:A4pW*GUiM? ]+p][ZZWFVԗLx9ŪžBto3uxϑFbƎP7&>^Qj<8¤}/LAQ|HoCnv fH@8PY{$!!>FbcpFp\ mg$H4WIOjMSǒufPp^ZK%HW Z̻%WJ?@XcB[)6IP}iUlʏJJR9*IMi 14h/kD@UF )K1j`Yк?^]{4`!r/2תT?#ݙYԸ%(Q]z;ƫ&EU7eɡJy5]C'4L  6J`\u koxǽ6A@iߖ۲VdS}i.]{Ԃ ]r% hsaxʗb1WfMT ޫs՝`d2Ҡ >@Q<޻RW3[XU0BS&l[9lT:uJC݋`-cT^4Kme7c@ҺMk6_[O8J>t\s5"fa]^r T#lHΣ/^O9`, ,0 ҉rd9s] ffveٲ!LRZ!:mtɽ8i7QFc Gr^面tSK*-8 cUikW/X/ngUD+5dLb|(x٘?;hG9OW;x;x˪GZž?ƉΈSSuI,u'uRӹUoݣnqbAO^S==H0@=e>`H9Nљbf5v:~;V9]Jbn# Wڒ?P/L2a6N]vAeTBL߯37@{JuÆ80K (MXi'.S٧iW>AClt+@~KM0'RYހף\z)4j=)cSIi8nMK&Sdê|݂U}kp.`ڬ dXcuB6P~\p"6+ofkj:Dօ湉ｆ7s8İ*ŔFmE*v ]i &KB9H2t w9-djjn?&>g4| !$Ur)'(ۆЄB]hڪRL͙g?CEhCC f43cI#bD0wUHlaGt7. _ tPp#$GT2~tdpdiϑb#i^$rVD4# v b})gJ1~í dJD斗rvV[D[-=D},r3zu}2kۻvxO}E`iuzղ{xIB;Zɟ 5(v`|n9?p.^F~'LKI_+_u^!wsY('ڍa-l1˝oY,}{nHhs>گ hLx)SLzLјL#Z<'8viB> [e$1@3"<&-అ`7Y~Hf!_Z<}ɦ[V w2ȤԮ<:IHv'Kh%Y9?;/wk\BйR+WoZ9ipa-S,g=On 2LxIe_Jw!Ք-*p0dsъGO ²h˘;~ IHۨ%|lnuqP[ W ,\RZFjsT+'7*q_'ieaC~%i]fjO Qr6n'6٘ԨLx 8&KZT^$(J-B?U"|ǀկO+T2ޔ-"o^'qgwJDM/`~AdYi"[_>uSGA_g9lۘ'2EVeϣlvZ`Wkd؍QAt |Ikѓjj-T!(QBʖPɍC[s/C*^2==jep%kQJЎL,>= /5gn$ $Ǟ3IH7XpKVue8Ԯ3=m3s[ߩù2#9E 9TĶw YC[!-Os^D U$N4;IT ZPgSp{moU76 Θ^+nD7LTsu@U ,@l-:R.g0 Uab[EaT kB`L[pՊ|xg9Iރ8,5(u!w!f8^tgIugX9H6[$M 2,8I{/q}MLʘ6}&=Y;`1Le;Cqر GO e>e ~ $WۨJ 6)cFk}K(Uv2w~ ԷeȈgӻHHl,\$5D<퇈Y*g|iK@dG{vk$oL_OEC'}N.ZHYب~ ad8-7&*pڄ5m` q.8ٖ'lRJqϻΨ_E&Zuq{qf&{qLρ=KDd&qǔfZ*YX> ]"`p2͓L2B:R:.f 0yˮ2$ikY8RTl[o#5G#VI<ƸXTZc<$M(}0`3ܶ܇f]v*%ٹRQ]9pF8ϊDZ޴+ 4Y%n+,,Ty>4h`?{>F;Ԏ8sB|ZMEZXhzTਚIQ)j-]Py,Ctk6qTl}BuuRQӚe[Ċ]zgbA#\ǭw9>"rFoaqNXzڀA<4' A%y\`Y'!>(YP.}Re/tC+⶧] @&-`[0'OʚbUk,Lhnx@Q/r(-r2?M>$\Z}RQGQi8> b:bY3 B< 'M5VIyA ܰ1J-Ej׮k{0I4h oUuhUtcz{QXY@L!mI"ZVxώ/Wiè),UR*f4 1frJB( !%*cGv 7$iYMŁ5&;BUvRq.l>!{z 6ġ5}D㙜IT0][!ty+PW}f Z4NNizitccN\MQR('hU'[g#'JU8٥s CiB!: ,kq.EG$[ -e36L0zjRwlG`T=h8"k71(vL5 B2\ͷo&'4K&d!(\}Cқ~Mu(!Ło $ǁ]K1 mNwdZ AAS,<kŪ-! AJ9\gAQq  PKMHdܵ@TdzmOI7aPEU+ilER HU~'88O uBlBr|ϿpS2HbzsH B4< Y\$3|UU,y:1h{ln9n?`X4C|z53&'V3^9yX\`")0y531)Gf2 GoV?ɶz棘l@vq7 j\<%@dXd`8p 5 9! o2'F-JBT͗mm깢8*6>8ED |ʉڨ5+<"(O EbsJ)#C9JoWfÿ:,\}U1po ΓJcL!_CJkb ^CFQcZVeSE-k>!Z1d8B+)>45r;Z{Ir d!_TI{'\K8 "jFnN*ρ$YjO^2 Z%ZE%AprXKXFe/ק*PYcO8tR $@eŽԙy IZA3.+eI CT+kc]Ahl5@DkwZȬ]F-:3gs[T`ԶG7C g8u;_= BM$.T?.s@̘ẏ a+Zfd㓁݂I (0H\H(o6 9:T>E̻K:Y1BGj D4#ߘI=mOQ"~B`p2l YtzʃcNyk{J(,#0/慅!/l7Q+}Y!vPg YKr6|A~ro8g.Wf{ Dm\}"޴e]25΋3.{ڷ dqhOPE4bTHQCAL'R"}B<Ouʒ]li8z0CNN_`l3=1|n-R#G G/_uS.s^fX?L sz2N 8^,'o. PI`FϪqLB8'k) =|cId,w.כDvvh%J0Įo/ l試p/.x,19sZ? WeqoKPp pY˃"2R qAL+`^րL / &rmhAObS>KCۜlRelgX|,jAaaCc mR=1crW Š NJcKZ a;\ DC{n *H8^ Wİ7}@u<f’,Ms,g\n咩qlv\l 4FɝT7 `r Ϙv)Soi:'6`r~߬Qiݨx.MxHPֳL|RkVBAEY1Dz!j^15Qs\TXN rvfT4cX|My ( bXfe|UBYe85$ QXf_\рzf'BE(DvLNau?.#Cq4vCjJAU( ޣ,ܻrn#f@S$[E_6U$̷Cf}ʧf!B`Bdw>mC1C7-di *>h %ZϙB&Q@!pxrA8s(۩TQMkt^Byob#c)j3n:*p/ʍF\_ '%Wĕ;ku99Ik`|HA[ "%򲷰xa1&)S\L~[2’sµ?c@<9-$II@QNs+p½tjh "jɻ?R+ 9&ŬY:*js&%Ϧ_v0Xm|9"#5vXjڋ>xvߓCdM߇\*>U\ybbz YCjixV)Z^gȍ̖)F’C)Jkltt Ct2Ц6n;sOfL #'q{h5!瓀-)k3Tl7JaN!Xww] Ϡ&gM4@cRb\"YFD!~*9uo 'y'ZrwQ8k(KAnpVڨ -X`|6! O` W@_֟bQZz ?(}h˷z_4)bFPB j1ӱC\#5ƭi=I,yF?5 -0I;6=K{nv[&oJ3A8=6)6KwЅI/y-B3Zwݛu?O1}$WDMͯ.&@bu_L]G?X8>V 12Adi'&=8Fy|by1S܆^"k(vU`xÇNGcAk7M`X^L3Nqb ;8{HAtw!&'@DP͚&i!daY?m@ i>)BLzns"#R$N`E7>r (w˴:# kNq{7尓$n$V WkBc`Q 5:Y<!z~&>e=f@ vjo DԵqbj2~o[aѠ[8&P'ovckvb6_A&](\}"唹!f(Dƹ%)]d5Rz*VoZq5x?gE@3ɔPݓ݌HеpLŋj)~͖3eގ׆/Pn Ft+m2+ vPaQӈM߸VqeF=E!b4Aq(h/aBx%wC) Oݴ`N|f o[r AĵMTٯx|h*x'.vY"WEtȭ檽I;{itɯRb\F}:k}.oSm[u W׈K &{cڥ4Z]7.奙l#ZF::^nJ;gt@5ƒ!l" ihF^TcJ ݋& |]! 鹦kߗ{}/pȝXVȻTCUVfS>fOc;) &Pq 99t$H9=P _lr W<yۼ'"ہy#\72$oa*H%Bs3_Z=5>]ϡvv ? jZ͔Uqlf $ʬʹ[\#'^pӔEFC7]`NyT3orfI<ŊИR$pJ:_!MSM?._Db0D+<($_\Gm;7P+@|[&j̎Dψ>ih8b;y;!ncAfY1ml\mQĺBZzapB$1\:}c$d6ÅͶ5|q9LI륎%yJEC '۩j /*JW^jRrW'WX303\-|`l {Ck>2xDQuxNBi]Oe_)5xZHo8p(,-f vmAp*kWp nv*|4/At-f]`? @ܔMg!8ٻ*Z? 'gL̹K˴04ى($dwӈd5(`P5G])gpoCzRÌP0Sj QnyȘa T \GqB5Ou9F{s }Ė̄_+{iHN3iнlA}|x'Q{׮aʮ.˙>l iyw* %錡=OEbo-f Ԍ%y]"50$(Rlpۃʨ#,Կ' 8MW C fͤe)3ɭ 8# bp4ȑ 7jό^ܯ~s"E`ʳ @cM/<@\y{d*,Xz Q&Ot#{Jfi\c^Ux68'*Z=ܐ;wo{ɗZ\v}/j9W*f2wx?UR!1Fѫj"N]LpH˼y\*l,+)h$Mj~Yp$I$f $+xIqT%lD&0kh ^2rBOGxPړd ,2Ɵ qn1x*YAr%8EN+ߛI@)'+&9j mHR69mR<Ƃ~u|8[8@jTP"Tc+޸Qև!<q1A3ҾTAj bD}YqZ<ěQiũ %pj?C8 J@Uu=᫟ȼ U_mΞ  pD&v ]lzƫDž5i,h T%$/`e&wgT\k-]&7E9 hhC8Voq̣7 ^(Qγ( $/Z9YG DfyvMʜQO68RsQF9)&fsp{wl]'vz4 uk(z0[0H8\rI }^<#/ !te w kUtzDxTc p?vd; ؊*L`q;w9#1ޭ;UWх[W5%H7Bwc>xDJ}#E9k`# W|?!l.u-fM`;{m;TB PFވ"Eؓ`=GܟьQ#$`GE=t;fQ<_G\-ߪ>#5XK-[0H $x 9h/ME675, e Nwh,,[*M.3=!QN\xL>ݦz7n&- T%Ƚ-t l3/WvqRs,[ 7FyQ3៍L5H.뼝\/[Dh5ؿ!$1%fBԯ{ƺسwyn#`7C̱zgҖC|>sTO/}uzN L㝹o8VwVZ~HڒiUp?x\]?^^My+{+$x>SO Z^;<:^Ű"pJ8ܑ?dyXJN#siaKZܰZX!c/c2“M_ƕ*m : *pЎ`îma#X|)xjhƃlܝZ7)?w{ K3o:I֠~[P޿ϸN+s!zg_ -$"eOݿWpܳBW<y_ϹbVg)@X 4x)X Z|pQh5ʘZ2!AfyAle!i'd}M@Yjp?!I.Uc縏 %D14"okޗVK Bl)4Zh 1f3S.Vp\(owL6zg73YH`d+gW_NP z9-h{F UFdG 4FjqdmهTXb |Zֵ#H)]m XPe턮F+Ƀ5-i_:py[>2|g1e3=/Vp68C"]-JĔ҆1H޹x7j\RN>q(Q'M5=gW% ?cՐ(Dcg߲Er#~4M(FK5-*Я^ 6 C+x$lob'I<~:)ZPq))56oMezlh{;8hn)"NlLkk^E/j`L0B Eʵޓ6&?6|d"2iCN"d;'e꽔AndL E8V6B8C^!ϧYRAJW g6GezQ&M¸`p@5]4`am5_ho`uR 䋩=)AHؔ2.k$C`_h"whhB.7 c5'֙~[hdLҘ 3mK0I_ͱ)f< U!*{ܧzݚG2aH* kU)>{MN;Q8`mCdKRjDoLtM L U?IB(}̠5XMz6^{D{7d8Ҭ / $w!&#[wp(H֍±Sn6?љe[0qʜl+?[N:u`8AYdT+R ԱlT:㘹|77Y3BMy"꜆E#eF&c}?;w~=[u^V(supZ!0OYC zB́FZ92G߱Jb~lfqqxrvmOIJ)pvTƷE{Wׂlɍm2g q*VJskH9*XY>s[҈k8jZϰ\-Z?ʷ#q{"lyӘ87Cm΀u t2\Vm(~Wnp­ໞJ<_8R/8X)Y5%,CY—vhW? 3R|?2Rt]JNf&!Q^@g/TUT[2@'avVB\Zu(5_Ej~[mBZ({:r׻m,]:jL<~/ ~h{m)^v0̛{r0VxR6rb?/2xv{\ "nrPdmyP+r>9ZF_Mx@ӿܼX9j9ܬ{lx\FyR_0Ŕs<5phi 4 2,P7f2Y2ՐӾ;]X8O:XNa'h[ZP:$X{]\p` r͢45~&:嵫$-35 l|$)W>-mnj vvUAmFE {7l=h%Օ@%m o;1P ?~룈ٮؙn5(Ip]x^LVa!6:eiH@Az듡#F{EYd޳`d#|f Or w)׎7*%EvvSpb79mN(&iJح8խ IfVyy9'<چ;B>&|-Pƥc!TaдdX˭~)@7e]%vbo@Gf? B06 |6xM#: D&LƋ%̮{;f٣ՉQkۏєoE<k BN[iqȻ ; Y=WE*9Ge"\oKH XcCSﰝȋC>q$èЪT./4_69kI\#ݷh'3ef '{ 1{)kœo}b=h fjORr.>_?үPab2]lz mm>'pX u71 K{P@zU9px㟲Q)7V1-/SH%zJN?Nu\\Y'eָoNeDKu~CwP`| *J)zvlRc!fy7FhR-lG5kE"!$j -&wՉ笛Bń|R}#=/ӌ["w![?VQ\.vz=uyVBEŕ|..C3 0j#:-c PTI=Cu Ysi;EukgSfݒd=S*UUrn<[htpowZuJ)mAS)gQh|\HǦRLCmb]`-n~>be`3o tP)xn% TG""k=.mp,Z(#C*MYSz؊UyE۽&Q8B"(TCk)c'xw?/";l8vaCyae4?'uN,G_ JJGm|xeBPWOȅh]+DP2Y}fTLC 0JL\\~ CeCP7mbbQD^W>xɈ%e ŗq{쥷cm1ʵ%’Vbr8?*w&1"c?>a2РfWاe,3D>TG)'@09iNaOiY J~bTp 4PVcsD 2߳ϒ< LLE NtX9#DvKr?F'LDt G֤4O~ϙ, r5clmC[gC", yF}mty#=3XmZK9Ɗ_2edetI|y>0PߚGf˹5;9|hW#) ]s3j zL.qຌ,rK;]LF,]ŷA¹:Av֕;"^J.9\U8[bOsie6DUdY[&=& EfR=^`zL I&{/[MS,Z4aH_Atj&Xm$ _N4)▦)(y5 ^>u?Ǽ J%ຖ?輶K9RYn%,/n10R kHO!zCWDFertR33#5#^Ns`VH=ʕ .{2pW 10e .qXoo"<$C.vV;YCj $?bv~Lf6ʄ%([S Δ[ ^6ITHPkŰd(Sn,ǙCySub%,[owC>3PSI_1uX MK(ØE}̬Dwx1}>rB{:+;{q'kQ~4rU#Q.D+]o5mp 9>f?yܧfWp0"h1| <%-AEeᝌyt POWLΗ=glS2LpK:>=Í {r2^Y>n7 > a:zڕvϋa|C~:Fݓ tvOPy\_i58j@iW[jWA`Ѯ?l48Rm~>\ CF4Wn>8St%`M7g>YHNǜ|{y+{"-݇yFPE@9PC׵wr2;G qbDook9hEWSBtSh|~*+΅ uGfv6}r f >ڦS16j4.\ Z8ug҄К"!wChwv%|r0/?}Ai9r2i蘇q D0`˷}1g*0Ns-Pʵu5L39B&qT`O^h'xY'ZC`8,s{YE9/(]L jOhw#ES\&FV٪Ƽ9y554w%zn@}NV$A RX=s ^{DUW{۴ĨBoš{|iGp^,xSڅ}TCT9OИhEƞ$[$ٟR*+hP8;^I;ՠc:M'RlAlncb.5 6HWNӀ lq(LEonah0lfj@G2W1m[ASR`tqvX1!G)NK{hHBWp4ڦd,mZ M2J+x)OlkK3 uo@gD Z\Nh.#Qcb=mՕ6rB-:uK6h zOw%gې7JWޔVFD@\% i_bMph%'Ee<%7ʕXE'W@"azV=ߎ>-k5_J c={E3^_Yy?\tts`\sh];]#EnWh (ٓxTV['ao|{4ߞH̿jT!0!`h?A-;I=yQ6Â:<6 l:Ȓ\j\`XPr`sy+—FISCDR䠡d4*;¨; 3`ڈ;6Jnd}O|Ml;ǥ&ղ?ٸnJ#XH!޵Mfn$QjoAƸXo&-1;>".\Rco;n'*]>Y EkuVLn3>"B wx_֘Gɣ1]uˁdk ۪-I ﲰ`]+J"^&9T莪,I{Tpu`ٶ6H`Pk Q[P1)Ve*ǹ)r6hx9j̛d8Ϡ2p~ght ۳ ]$"Tp " L6Mz0IOs{q o}6&6I&oA҅6YcLpެ\ u4C9e}^۹a<_aTsA&tJYAs4A+J{i^x@uH4I9~|K߈"L^=1~L9wHBS?!jJ.&l M| ݦ0HH^6COb8u~wQED=(<V \m,"2ndFXaD<nL88l˽{^~ !0ůEbt-|Ü%/(SFW[s};@_(M*RМ[;_n# tq =rNrӇ kKi =9oB.d,?U "6dt.',s A7s ͭAhħIoF`w5\up|!q $^YPc6x9{^=XFj%nPJ+i8u8 8WN_jv}<hS}( X TFfC0c7 ![/v妍M< =6sdd\ 9!J. 7G1f]W*^z$m)_rUa|G 3GO'22e?KV>yB5I@RkIZdJ(j\<Ho묔xjN;tnfhTgBtvB~yj_cHqk4Ǎ`=ea]MRZ,Nm0ږT @kvTם$>\/%ŲH0ۙtjܐ(whl/RqX~FF澔1 2< *iWx2< {HD ؠwv N| BPWHV?" tT_k)o*_EY(=cG  XD3x(H\de,kTIVJo8ZO\4Lrπm Z .{NmϓyD!l+ πYcؚ(3-)>HboH"<\|w?L>v7՛YbL? /9v/cT֓zVӵcJBG+Vyw5TSvrc(v'ڒ)wRod;p e4ُ7f2Ŗh5eG&<<,UsGy(Ki*2oڞ-7uFY?dM_uWk'ڄehI+X)R/HB`;dk_El d<^3F7'+\q8ZSNޘ5\͑4O.}ؽTJ4{?6hZs2AI_}_8J{HGa6v7Y>j~/':z4\Eܥ-g>Gx()Ug 68R @&TFBjTFx`&z al:㾅awG~BnR㯹/Y5dív#δ>mM7P~\(Y1|sՔ 1 Kr`']7 A{|a\"s"[af=&FS dz8g>8KS1>0 Rg>߽%ǯrw,̀bZ>[bOYfXUUzpKHHPԄ}q31~5ny#G/?1Ff1Yݾ:RJNF[{z*Dض}-`D)@Kt]uA3Hx@O\ѵ 7jSL Y"\ 2< ^84SPURɯL˜MmD.>?ƚ\z$/))g_;y 溡Ɓ.SoOeҼ@*fl=FJ uຨ=*W=#e9dΒu4wElu_suCo׮aN %'tcIfWR"h-+N|-Cb`843OҴuL$'%jM:&b"s}Μ嚷I6Ae=Z*/\ɮvN{:ܤ1u(r s1mοZIRC#_}\Dg+jiTfM %ɂt7>9W$r80"q:=pD @LOO8壀&D:U]#0ibYsS,]`O|L ^W;!}'{GCbE2oUܶšlD6@2A#f*,H9A}oR2ۑ=GZ yOE%խ.Ȯ/s-.9sWpb3Nx]UOkqJrfZSkfu%wBV&r] ћ^lmxVKcD% eN?S$68ؽ\: D_d tp{ff!eghBL4 K"Lw p/w{i 8EQI5_Z*:j:̚#w_D`؎)|TYK× g 6>Ъ-z˥rb ;xfq LJ5\1 *ے;D&?4y|E;l2vݕ4ɖ>Ih,ВIq[QS%FҋOsOZϠekjRAޅ&:xքgFV? QI+ܐR<6! W??!]q/zTuz\yr<_U$ʑ6Gh'3&N5HRyK=Fo9 MY{+"!m'qm)puy8Wzzp%4|QE&1S͖J_ny,c]$2*XAA &;MgBN @Bu;'H/RU< 7zF6Cx̼yRq4ZKϔ!_w{Ј{[^9 lTu[>\>|vN]jmsSDK',l!;$PơjQuJ pEhDh~Mh;tylIO*sZh*l{'ݚXrV)Am1cK PHF[ma5sh'Z1xQ#H}po wR-bWx8G1+N0494*DaO?9Tat[ȗ4ju㜣vV$Q6\ v1>%.hj42@{v:K+eZ]q)RSs`Fi]bi;Wbu;T:4'atX% EKU zSphy`'a;3'i{F \D깯x8pXfٵ>ԹBng%yͯ \+kix4C!`\v"_VWv?fW+iSZán{}׿hoFKuvJA!Y M,wqW]Yr,_<ɺQ'Hc'g8)4kDBIw*b=[zJ()3"{N iGB$v.yo*QZ|h ~ؑ>ϳO91WX^?}hnJ u-l$&7紖ŷӛ #שbO)!f> xN"ϾGoM`ֽx, ##Ԑi79[lTwcy^X!/*qS+MRAGZUEHȻeo&kl,ɉiv!*&&r]@}1wܲ8";=㌿^TwmWzuNd҂G:zu ^*uy5wW@`IE\2OFzwNHC1)O/xųÓb47P Icc妝M>tH'T|͡ |nNoFzNU.?$Z]1Weff̬My<ɗfKM!qa(i8*(vG N*#?AG1۽ $Z3>>NߎN.UuDWѮ f5ʨl]*(1p3z 5䱻K<(ffb/ql(sz#9 qF.ȕyK8Ó*ɦдB֩lQ@]eu'J=JR)ʳB:Y/'7<.Sj_Bm I6-C){7?n`2]p1w `p`upbLq taYǰg"Y ^Ѱ"6Pũ0LE/ dV?e(y?2zES1 SjReU6+%yK3BąQx.M@&[QTζTAҟؓTx4*TK:`VOrOWb=`\pׅ&6@ 9050aPLVixb49ÀmXn2@T"z el{fTǣ{wn0:et>.,kJqD&t9@0Bq7]b2Ƭt\ jkT؉sЬr9a7˳xr{!l;_)$].1 K05 |>lͺݒ> W$ē{s_cc˲152tuko?dl^iבB> $(Ӷ'Us\`c'k^=8$>6{ZE2kr;aA( ikrr` ho!)QC>yAe2^+SYW)p Ri Qɖ Sup4%J@V_:rUTEJ"`DW͋w+߱X`g+\/Ws,YX^Z4NA=~"ijm 9"оOԬio Ry\3;$,~޾[nZ1wVHxRA/mP)E7hFRsԒkACt&.,xzU< ź&-ӕSJ!(I CGImg?aN}i, wTWsXeE!9ڏ>0PBڷ3moq"}o%8I_'+] ]Mkx~_ʠvƕ w^ e[Unƥq~%{Ze'aXTvW e+Y}:LfE 4hP3 {$c|ieJ9xjGyЯF^hI:صMx*=s]H^ɝ40>vznRcŊ_u oF@gœ?5wr'RY="EbHAM(N m${5|sr}fh49[̱p)LuK}?`=e* = 3sIZi;no[VEg.+"F4Nm1 A ~ +'w m<֏۝_;ZYC@I ,V=_eΠtgyU۽\U0N[A+r{Z@᤾RI0cj/Sba͏K3e?z?W66y˩)JY͸,BIRc]S4D?WWDQH"ýCvqÚe2 @CSȃ#d 0 b矞lENJf]s!D.v0Xʛhud䚝A¥Ս$O-x鉀 coaQ{ A OxhvG:eXf529&< "MX/75y*PJ_x ɳ_m6&d34* ޷RZ~lK 21mmHLչdϋTzju lֿIw'{lƍ]z}ҾSOmv x4i=pTsOdj-`7WE{ 詀"8HziQ:ڞs9?n-vl{T^خB>ex &1m}%/ c]S*[|(09B~Q+vLjDҩ .K1W|+UM&MKet;i*c@T1_*K<`׹MuBw_r9}&l's\sA ThCgO v \Ĺ:H]C ,j{MIk{xO8>9qF_@YgԨe.hL.e/mv&rwm5^"YFXi#'B +sK\ezC#[``Ȣ"*x ֲ؝ R̺wN޴Te?ґ fOn BPC oy6x]u~ nv!QJG׷kn]kk) ch1өK:fWW7m(5J%QQI-.fʤ&]Aa s L ͜Q#kJ[Wd-4 bb޷?/cRC< LGeH+NyNf__Pv2M%)%21eL)"gPЈ5!bݷ:L#x Cp=f^x/ [ ՙZ4 .ulsKeoc95ѭ[V $)S D"81SĘl 1Nt?9*ճ4oHR&A'/\Y/S'kHLO(t,ƥP?hH!x:>LM<7ަ:#hi<a> 9`NR[iYG"fX[261aj,\š LD%K >;?@0ݫϴH{ c>{/pǎ>ЃyIS\PmS8^JrA凊 (W%,^M;@IU,Sx<3s+1h&g*IsdŁ<,cGmkGx#G\-T1.ݺXhCނՒv_?zT˷Y7x%amO,MOK(oGҒʴ:fWʾ(7d>kTˋ7dj0^c8u?OÈ#Z t2' !ƙvj\($u/ D?Z-Z!%h)Bp 7ay蠻5:׿p[C?(*~6ӫsߣ_%ɍ{ UOtF +Mdۃ~x]](wǟk5;DG7s'w{|jG$IrZYHkn95ds c mwFSuSnA,=+Ô`ǚ,.w5lWS-- }oV<9CZ@sFu:q ?O40{"IܺF9o$k+@9YQ^B+û\K!KdھDe-%) Eu։T7Xl*snlC{t`n>*W󔼔0L ń꟥ߗ=~0t"=SbhLeL2l'IÁ)O}TV14>dGS\jaLe2Y_9?R8-2Mԩ'lxB.9Ɔ|IQhQãHDC 7?cYA٫~ L>M sc>d䊯>VP32c>QL&ĿLǞCH R,1 >(T_Ti[J> f)"%ٴ[qNz*[/Z/t3SKٷ!}hhJ_ow!gn:v8n=NJU{dHb뙅r1-A^&U/vF5ǔ?q[\=#A B "W,Һ.zu%AY$EG~HrxfudR p\%IkƟ3NM#ZQ s-Elm:ǣ-ޘ}!%Aq-k]Iq*U峏YMad&L!cM1r?Evm> #-<5tA V%OC,)o-g/ܚi6l'(R;tMyQLL{*:,*YGJp*h=ǒ'%b!s-Ƣ6I8|*iU?uj,* J\۩ӗF˻g ;l2KlqC H7V0*L[3+x|.1aBBv~r8q2u!H|>pP8cS QpZ@;CDS K*kV=@O 3cܲP %'GOnMu ޒב&O{M*^ )6աp*7U"eڅR)QbbqVz6 )7>٦/0t`Y m7E Sp^ߋEAaAnNpO8xaR O3_L=g3#,?C)?y z̫BA^J[KW&? =Qkj)|ӆt-C`Iy#v119!yo2UZn 6j5?;S 2ë 4?`4=,&g٢"CS:,;/E P;lP$fj[нF#&|T, 7$ 5@YUE*dxcҮ^b "1(~59zz$נ!Ј9H4LcF Ǻ*YS1t ڏ gv&~ FWp?NWY=CvI6\ġ^،6v6:x4@+1uH$\?zXzz=If{R,pJJI0DpRɐcNV\ A3hMJ;7[ƀ::fʢ @fwG+ 'BX;nMnPyHڜyPMeYF=v5w"-*j II$gFxIwL N̵qtVhiy&e2ɿP&h>%$Qޅ~k_*6$3ύx]onϫ5+@ %I)Caa EOVW^.ZZ gU9F:E3UtJR%Ƴ <׃?n$͔6Kd!`Vc{!!VVS ̰`K?9BӾ:rSxQeӿۓ]ⶓ@èӻ*dro +8鴯gU鏘 3Q*s[|^ElɡWzbb~ϚXo(OA)g0ϡݸ-Gߡ~+@ۑ,^vn=JeFR؄p @TzEڧʥvDw 0w2q;/k;Rn-W-Ϯ.r{P>13=H7 -x>sr믢n#3H?sz#Ya0~D\Ήo.6<8?MQqF:.E|=;ǒq("F[č~7&w84XLꬉl8aC8^7KϘ }/rq\3tu_?8=f5`um8d$dj |A io\7U´X2> P $Ip8Bf&7}#r3Y|]@F hF竮 ||;2%,3rn_#o1]zj2z;WUsH4^GSq*T P2ml8΄}TLdYk3aw83(%Uxv;ptY&N,(~\JeBt?Ix%cx"a$:RAݗZqK:Q|P]jQZ'[]>^wK0WȒSqԂfl*ػ0H*KT4*>(9mD@S\ei6BZUL(lsMؿ³Ro }ĈgTؤ c]ܖ(8=*\3B8yKRe\^}Uv?X-N[}QUK9zCq4w@Ib#C/c gms4h#7g̃@IP[Q4hI^Dߪ؄Ryy0~o>Ց U ? !7q.UgTN0nc} Ÿ8 m, FE)-pw/R{I\~OჇ >دZMJjmX|m_~XjbF9co[ k@#S? )d=Ǝ).FtDW˨ )z_"9k3_@ižN8_+ΦwCwWoZ<`Fx ]HGch)$:;=Cgפ^s"TG ;x씥$Ji鲁 XجI8iR,C)4flyLh|*J$N| .Dzj_>#'W3CVxG&.EL5LXh}P95q,gm^Avd<7&凌du!)@vhQه)(h:T3_wt^P?KB7^ c' cW܆3h#XO>6$o) H9Q@$k/4 k2D9.N@[,ȟ;\:Mq jFC7_jR!̙m*-7-աm0d~YsHse:l $z/z)Rl-6P\uV }~?B}06h-Yt'+*v-ڼ2``s%s)rx[eqXWN?3V ,z݌+$e5ZHs諆u3](0`C6;m]^SR*tてI<2ղ??(*ٰw5(֊-3ȩ0z8964mkC (kyv-0Ió9rVCv|>eňUH?C1ƭ2ţ:M$i.;Nzƕ?"?@Wtl" 9; 6h%Tjn =nXq6( {!Q(c (~U~![Õ샷2=n8sz?d1,Yy/?cB$Yhm!AF{`,P!Ia7?uj/]DvOSY &t|yqgTM'븞*`~˙WᡪseDCO:C*4m gpm|;;>`1(״D7 D245s}{W:&9!cc%{1jpen(0̋Z<(,.k=d/QZt#guN݃" ;kux#WGӈs"S͟5Q=X奎@INt P`.4mqln^ug]#v;N Hz& ˴.O2&ӗz٣~i۩RS{ ˔N|&xφOͩeOA}ѭGg:n 룊=%f(DGcN7M{qə><  h ߐ\mr:׹pab uvu!BVQ3 aeTc!w]^ϡmvu>Xw,U+\hV!w4q.pGX_ wcKsPD u%YOq2)bMm0Ѹd wМ֫+j{ XL]
ը7ybջl#}y}=mhH/rWf"~(Qnbu(#hd^ON 80(OjldBJiRkޗ7X٪y8u5@v cmWƀvҭ;vhid0hW;5uVvNq zɈÆVf5!N f Axڧw0-l~/@-Ph~g9訞8@~uKhC;Oa&ֆ a%Te":61~8aHv1P(!Ka .3rl]Q/ٮ-,KC#N, uPK*DU P~HchUcv&苾ch?{&qzӉ O[D;vΨynXl;q __+Uj 7 ] o_fzf[AmBThTWkyYںUt/&nPhfSW7E% 1Y?l-|m[ث1M- -0Z)e LkIŗD%pEi|5(6pE1RLI0h̰yn>+$Z)rՇɴ?syy” v另J긆)n[cڨgĊ :QU[(8f: "U  &(o#{>Џuf@# P BvXsbzcFfZF9)KE!mR >B^󑚪b31 ChY}4ֆ%@i۞>o)Kx0ZňϢGe8ͫ>rZ%Fw|s!Ԥe 8hXU: MF4켻y[ 7B%V`_VoMzgu}g]%݄gt ;,X0I2SO>:pVhd$.'UwF]NRAϒZ!\CeFrzCNؘpU܎#cKUAW6F2b'Oqek~ r@zZ'gЈGe~^ϥ1x4 bf q$?.Fǝf[~/? A ́rdv%'=*ؑF|QjXa:gN'g3mx8VnEU?!GyN'v_[\Q8/=MR0xmS(KeLU@#0*MkHo\I%OUWO)W _n8J+9vI1TŶ&|\OY}7EزQsݸvF?|+r 30+[Ov:Jh+0.s*#żb Ps}EtAəlߥ])+HbCĆ f' ?OH" <,Wn2*]$Ru1E',.jH%AA=($Eza =98Mu^4sd3K!Ϯ[8?=v/dYn4NmW0k5﫷#<M LfJ >3JUZB`/<.Q3 {>PTYsKO&]?*<94WBLV+2DŽ+Վ}?Qg$S_iCYfxE\p͵d(0LE~(ehOtjT5^A=v1UX]IF_ c갠#Z UՀ^E=]r<ݶ{_ԈW+)p4x L-(+Bhxsn:wjiQP{׷֠(c QOt@\]j[,Pu Y7P_j;uh b1"u+QVJXj SA0?uzzW7mzԢ?-O0gcdIGIJSO.2a(5'7:5Xk,1JC&(HD ~mU\JnlpV,7[ g X]E ]q{ 2׺VX-b8AG^t&'gh,cGҽqp &/(6*;H sٺIL 5 lu.+8_Kl A):"RӂeKFڌg&>$aYd!rCӂt㳅 c815阔%뵌K EY%5y0vX]AO1-(_1C7G*ױg2GQ:&(|!4}v@xcd.DdsZ$8bd=+ QYu$چHQONM*0/*e-,N@Voײ`jXTt742ʯ8Τs lh7r ^TаPR ~fN1SG[>Cq@`(kG RIA<{ $N8ڿ,w,'Lƫ.Aq7ռe1԰hvfy8>[? /lua 2،PF9?tFDKj w*WbڅKXu#[M҉w1@e'!,yF+Z~LVlhr*w!C Pyzs]2gKu- "ՅȆ'%mdZV 6 ,w D_d^[nj5)&=yߘZ n'DV:2F[B%v#s.,$S{`08`"o?> twz-o"p*fTEYX<("Tn ztD%6XԯOP*Z IҾ0;ueG ^LxG/2n7Xw>+{uGa?(\i8f 5Zg0S ]h|?Py ,) _&(Jr!20'S&l R7 /{hs$4Xp[ l|GNc]eaK7o;#( w.`nlo 1N>ؿd /RiJGB{Qqn\L @)`rSS!2oR5yP?ޒM,y[1>(/i]7xVw q-9_KDGqoHcw$N#RQZvNZ.FA"ZdAZ{ZGӵ$v+8bF6Clzc7vkEI'ŪZ{jhS Jj^U~=Y,*{>'7mVEjJn 9:-K&o>sp랦qޱ~W):l f>'{ݿ~m+25h́œװ~k+#'M:n)VA5tG%S\k)VJ[*e5 Hܕ@Јtu#shkʣ] nٗr:d!Xd*!PIOӵk$.UO2ƂaJ%+,7okK]suG nem̲HXN]W=2BrR%*W"e*Z5QV2t}s3OWw%>'w2_- Urn ԝ-TF r8+C:vpӄEWNaV"oX:@˷=Zj(Ne^#Z#C#uBʹ9ýDbC ei9ssXTaO浚zscFTӈq{ޟ_׌|k0\j~ C,7kEW8Y-lM3|l34!X:{5zWl=ď38W'tS#[Qꩲ|C m]lYQY3y"u@8!G;dؼ-oO<<qЇOIPDw 7O1;+Fn7uE:{e'^Ez}7 my1Gk>9՝ʐ _UګvۿۭDAswǫ(1> ٦zb5ݖKݏ_` \}G~V%w^ ¬X8aSU䓎TJg8s{_~,U٣;xL՗!P iLS+rQZHrvUg+qXOjJሮftSW@3Wk&gcHq0jLLWLi-&;TUu32<6VGqx5dH|SV?"냚Q6P1Wf\T=r꫶o\2AX:B4QQJ{no@+F kB`ܫc/x(8dxTm& %od Tgip۪2ЛPm]-네,#l5\U1ɊUWm j2 FΔG尨ڃPuճF]Ķ%3z@f0pUˆ b)6'tR9o]ٞzK (H#ٷ̘H8-!|<%mmt˰o~m*`Sf1E @|[HzM*H(퇞 v:;u%;u@qSA.!2Xb!Ykda$K?!$}NA+w8WxQ/,vNN,/-ĄXso:%=ksgbxUYN Jz+AMa{79ĽN߿$: Ʒ /=GDž. 0e$l`?S|Đ5⒜/:LGQOQkINBSet(Ƌ_ GaJlt ~*~wqk{P^|/20Fc34y DMފ*E_2t]>!@5HEq~[٤Hox逇ܜsaRmm"!9|h˄ ۛH|/ǔ+bKH){8YT/s5)E0!ֽfqCIH)[q^BNL$Иs$ 3&בeem9ITTCUExAܐ[ݲlv8]9jb 窭ԚrbFzڰ(UtTvcCgw@8$ ծT'(yeTՀ uH㹽[ȡUyL|#EV1豘8R-DUXê %E𦄒D{֑tN7? te%&i@qH|?(l0o X*vKY)}Q̀@ _Y*.+,~k Wޙg:=qV8Cvq?"pŸ3" |vV:lո+2a}Q~ {raڒYExe5PWԹHZgv: ymmOƛXJu/5cC33F<^ϭsvY(m}`#xJs,{=CY8`r`5ljN)+ Zpr..ވ>TƟjs"&:^}Ck0ֹ)37?BᙃA 7Cb GQțo * ҩ%@; 蝀λ x*9/?rIR RZFAVe Ch{f&Y&t=$">MeT(!gV-cCKzbPXnѭy,3Zo`ikX%=iR lku#\0Vǹ˃sepVבCTEQCXufNHV Iv˸y +&@EAGto:,a0`Xчui⢞JZD!$2hL\!Rs^_W+t2+ o;@r~ F\X?N}iiVLOpd+$+*ç{sT&HR*~CӿoK.E$ *&,_24/SwՁм"ëxđ#KfPRGO_iU9n}&dK% 8HU?D}&6|d.#W\O8ZLoF  ^MGz3nCx\mG賏tnn*e(ggMiaKk#3^!6*$fݗWoJ:Dpfk8 ((4Q>~Whc!U{PEHo`4N{G2cJj?ٽX3`wQ߅2WOh>N? B i#OKpWeAcp(|@A{li7?5 h0?`䡡&AvB`#DHwVyx'*%pM+**xUW&<~_J.ZiSEt4*cόb_ QaPXCQ{ľt `%u.Sq}Uo86qq\3T-eCԬcCuy9j@QT9ݫ{$m%c0ؓ{Y|wd+&.nw5+ߋ%`h2c{eRo?3x@sbRU9#sjXFz1y)וV:njGƜҙ`{ s.<3>O~7S%-Iհ<ИOhNj:jMr}BREcfmc~j+W ~fA/CnV&? A Mj]ϵ!)yPYߞnŋUJ_5 {ZNQϗyr|SSy OpD#` ݇NdC5^kPNs 9L. Aݎ'=`Wo>@d9ZCCj.A 鄅xzG{BE!Y4zRm1Etp6e n#u5kER4Ϙnt೑u3˝W,+S\L4g)\Iau8dȝdD=S3fS_?VV|Ʒ2}#Y/ߗ¦6[M ZX?˗P1HWqKf||mߑ; #LѮ6o:/=~ O!iJhOL뤲_0Ҋß+'aMZi;C@V|~Ԃ9#jrs$x_ҧlVP/]$ua'Seў't)˝k$w`VTZί=^tѰ6Һ/lAp&nZq^P757b8L&H[g0{ pɊHݾ8I#]/R7Al[|+ 2r0JKLiLWNvȫ1~/uX@=/E_޵;$8,P@GxvkЯS9d.h~.aٰ8i@K$W:z`׍ *|l=Oi"N1;]q=#vZxmCvӁEcA|xի?kĆ;~ com&{T;Ҝ2ڠ6jcV2'E`(ɉM wW16]!'T">pǤrf,0Zil8 !~ vPgxt`ceffJdm]Ƕ,\=GB9z W0o&.8[X 7v >$dV:D6{ ȻǭTp5D$)mKqpa_8kf`N;&mP @)d{ȼwdgPgkQHNk"sgəùٞ͂<;?zE,2ds#ye_Q k \uA{ qȰ0"V?A0+2BxLK~x8%΀f*!Օrwe{/Aм[sQe=v_ }P= qe偉%;YIwk!? gzr=@-ュk>C= u`>HN!y9$A2bÇX|!t0;o9Ȟ>˵0&) ;,!կwe+(4ǎab{vHN;l_&moM`lTYAT1Ц"$t-u,6tAelXlj @hl+&l$#,sKQFphQM#C?wc}ȵ?=J}fd,Y 9ִ.kZƛ?ٓs0SKAJMluϖHAҕk~y?McKS)0Vƀ,/iY׺|Ѩ`JH"| JY/LaddBew8YŌ .VB,ߦtIz69*ex(xZ1n:M LEXzө;uPrN8kP|a.b-xk oĽho $ V'ȢD2]oF/"w}+ <P/n"E!v-MO|';5"Hp\'f *%<[u:􆠯ޘgq7PGn7g) s=NiAݞJ#cD?pI wN'g8C)P .RS 3b"(1QS&E!:y1wK>_!`k Z>B\ (w[D*0Telt5x:Ti["^OL[iZ8/W'Bq`9c[ZF޳`l8}Y )DTec|Cy)c9UR#U4=!ׂצ7m>P6)_c[c= / H40E=B{%K6Z FK] *+ׁcF"iQ!2g-K\ 1jI,z=]5z&b@8zjUQ! ~aZ9W@X1'E%K-}h0Ȏ&fk۠Y]1 .h|R-IUmeĻoP0< 4>2?#G93A=^ P.ۇ.)*ndBf'Ⱦ^6l~ZcwxX6 {I/p sz ւyigD0ٖoMC-HSY3 K*5=2u }NV|҇ohM _-$IbDYW4jRDtϕz4DJ=]kO *u˚xP>_B~;kLbXpc8Fd)gʪHQ`3^<")#:Y`[Y`i48:aizrENªj7Þg9<=.O@q{( 7B= Ih _돿Ѥ/!Μe&%!X Y/iêVVOLP˴ q栣|`:d\-c*Vw[tsl2Cmrv|UHcDGݟG'o 4[a5>aL"n"è$؁2Nk ڞ1lǎ X;e"M/#(@OUv.oL⽯4L&C'2K<(8rw$h^d1+PKFJ{Dў厘ʲ(כK}tB!0A:z̓B 'ᖙ^oQ{zI}'CI{oYQ vu:N{%Ưr; U?\ RI.>5X4r{eCOsZ5=1iaУ fpsݲw*W-I;! -Y.3zA˒dGzzS vioB|0 8A;vВ> ZY;[t'6f,~@TqLؚL[thOqg(Jp~^o vjAFt6md^]QD7[Z_%Q,4 (B1V]|x ϐk_Hgu.:Ųe48U}^f~@M\g6.zQ&R۟R:|O]e3 DnCoN=mozm;; r ~竧|9JCüΠc/;0&wM*Mw.[uZ6gصdN!==, j2yLCsT/7R*Nu:;M J&~XmQ"d߲5S_A4|{]iT`^2OtM FCfVNu\ ?rDّ .NT[Ǭ]^W{Ӄa}r[wԨTxIJjUnsg.Ԗccj34 -^5+&'ϩc$oJ0|P`~c.,W!Ω"t지P=.:o7cIԮϚ>“R+" E>u9SL>qWy ? ?3;2&`>WTkûnMӋ.K)DyPpr6M$2 QrGGR[{r,lF TppԖ҃ΤO7vZLp\z>bg>cWQ&a8kKVZ *]흑 &^LH(cetxR,] ? ֱ׬$(b/iIU?8ZBnAn;j4(#4}( wr_kY<.m)]B=[L4mFgrj[_pr"C>I)wС[) h :aʳ}e|}m# (a19hP{D_GeKb_Eݟ!+T6emI 졩нڟ 6SBrFiMDfih؅4sSmuEwʕ l;RgQ+z&Jl^aZs8/VMI*ъC%,Ѣˡ_o-%ҫ:!M3i6>4).H56G̼FvUQЗ/'iaS1KH?_qǴcۇ(Gjy;d:ԇ UP~*8t#i@@!b! 6v[m+i-"=Մ$>…1!4%dy/P6"7N#L& Ît];Y1C[^Mb52}4qgh_n0>j ;׬z-=2)x`_85~v`1|JRm6"3hdyji°> Rgָ`V'Tn}Aw^a:xcOl{)`e&? RPE/fdsO\/˗JZYv5i5أ3yc8i6&Dwd_gzD;1]Ņs燅CC`M]o Qt^D=UaMpM:Q"p YA^Fnq6}{UWКaڄOm{?RZD˟I}\LJ؊See{fYP} ;AYYVdE2[\Cl"ZR; /^3'7oSvn櫢Tʹ>\iMGfAPRW7{d!%OT%?P_,ثoCANMGV\Q9(oi\WU='B[oWNu.ڲ=Z'L^f@fYI /=2`|/W٪%N 0OWS^ Xk & y'`f$vilvJdV)4 yWJЫ?cLmiAo穾' /UsON]zdbJ`zBqf>I#etƟA.Y =wW3^隋தY0Vk"]8#3uV89ּ|YY+6 0ʃox6sQ1$fյŐ#Vu#0 ڡ62%t/ ]1>d7XQ9՟rӼ|M(lM A4Iz$G}bA H{SyaN?xh6^q**5&=KtܠMi .OcO҃?GIyTmv6'GB윲&ٞ*hV:A)q)glXlDд*]f⋺ҝFkQ˺5XqU9(x*;T\`ع @oԘS᯳AC1\,\*zZɸulW]m/^(2L)G(BZņ{5 Iz{̑&fyQY)C'`/>L?J国:KoZdG@r7gC@1 ),"Bo4!Tws4҅10JѪ5|[9ΨEF҈ٻoSYdpQAk6h%*<"do?g\9JrԠK+zqؾ~ǴI/r< =fL~1 TE*Q$#7Qoa&'1sz7 x>wo h }1rV3{U1,CFd _A)7hL͠1ߝ A .^Pp\ OKYU`r hYVGPB71t&`R%ĭ(ycA܎2\ė5*EL'zz>X;lԺ,ʵ'/ F]k =LSg;vo< w[ddK5t%qcMQZ\@}$VAzT'@΍Ha ٠ޜӮ}& FBTFR% = &֡CEA?mV)<'J0-'v'[ȨtzWi$wꐞhǟ&>e/Ɖu|a2&T=&+HrYxMŵOT[{bK ˪#ۼbq`MLVo)28vs"hfh,*?z)]^ էu?zu.loϦOzy5! ^,)b:Jd/zI *(BO5@y"O .5ߐK$VFUsf/5/ovW6w'7xV3 ljlKRƄ*mhJ`7 7Ts6Y-gtjg @<YMU~&^- ү1H4Q<Ғ2+ցm*_F utӦce?Uܼanu~ij?lHg ·)R.Ù!^}N"y;/z-jyW"4{LuЄp0czg&z_ca;>Oj-@T7'\F9MN#'+PoyI.5ii=|\OZRhk3)?{Ax2;$1$(4r\rPďNÈe :V_RQ3YQdۄ=8ke\Ȣ+<#|ܬ mΘ oKք* m śUI\1Q5αԻxJlojWp1M[4Q~2.0υ4 D UJ M]9_~vD$gP4L4NW Ug wp^kuǯA"fs =» Ϧi{> rAq ڤHn._氌!>[pZYi+]?*7 ӿfreuE_ )zK(I頻3<0.ycod6c!GˍpF6F6H645qBXt\+۷dlxlxl|qIhSN䓷. =fw'wE~/g4>IlZo&+Vt%]eaG.ȅك+c[)( U!vp+\8~$M-9zOhѺ e(۾0"ω^y9j#n䖛7gq!J(. "T{@68n}iYB'>Cэ# իN5y 0^/}o&N;D+99e|{Y'3TsoWJF )̦r;aZ ZIx<gI  %)ebߍA=Rg6C? 8x:Op4j~Ef( $\^n$^]2 =-4eO]Z(XSJ%j׃ָ+Ka~PzVE)046WL| 5Y_)Dv:ƷueRn)iho }GJ㨭ѹ2G$g!wS<53RD&19pwcIfTdImy_mē-.x=)Cm m m$*NIg5HFsG-er/ Rl'/?jC/ckjjFoepۡ3 ڈ4\sPGY;f*d U,uu=Mrs%^O !L4ޡԑJ!CA4MB x՟5$]rȣޗuE&$)$PRKG֞q{WcjQ\YMܧ5mk΄:ǮnQB-Л14kvXuC]>V\6Tׇ?K[l%$l5٭>tDKMs8$f E2^A>nfaW[{9X0 =\ )iK5n b3_`,N/w 8j1ƧBbi<cTYL/7 ЙI(boѭƲ%%s^;0ӪGRR&D/A৶Ujlh8ܒXiW+gz |:zTXcƜ|VqB'SaT~P,0CE6̉rׄׯ-_F]1bx&.]K=Y}Q-59#i{R7n|71Z `LEQ  Ji)"L´N埫Z5%4ru:8uQʁGP}r]ă"E1!Nkɭbp[EӊI+"e <)#۠kv3`8W@땔-IN_Tqb2E'0 g Ca0#yH =m*(>{e:a4EjJvVW 7\%!IjE O^)'7%im? yz)c3rR:&O'|8brjj+& xEke^NdThka&vc$Y5!n9.DІFVF[HDlQ[٘pT;}URuHU+ _7~'׳PxysSܙ]p5q7  "Jk6ǔkn%LP+!;oX˜F/ehpJy9 uUJceCnG>GzUOiem}( 7!h7xN0P)%@"œ7[rlگjJZ2+d i(4^2۶h2|30E'چ{g?7"=-7fو*JMٗRJ7 n^0KRwʑ kPTP=%=C|jE (aamo5?%&0:޿ql; ޼;b.?tˢ*wu,2t'fHdb'瑥?z "PjӺDžHtEIrzKbڝz%@d4opmwP!i|"F?׆u[{юAR@MV h n_}چC /@U $^ FDBۨzí+h/I2O&1殍WϬ fЖ&al3OCqP;K7l骜ɬUKyr++9x`tDxG^Nꂦ{Ӽ²@ xcM1 8oS(y!^,feBH %R423΢KS!s'g~w;:jMsrco.XkcuK.QHH{"^2:}m>N0˸~kɳ&HQZw߷os@ oJHv"Z3!]WϿ^LI׃P.4)Yt0w~p/!4Y5v[ MzjO9}6wsB@"t,Q7}}FH\*u:.1!7EƣA&BUnlR-0YstEU[-'򩍅'-6P60YpOI@~w%C ZcA$-FA#K6kI[~ :{:ӻfo-7׃<@Ee[ P? oI:VR8,oX*CcP}-|tr~^ O-(q#1(Vt_iB$vFB#Lćf'LR-~]~!ỹ/d̴Rh)T" bySJu2m5"|Em+-{nJ"'7: vE3یS,9h8 Oe&kͣ.O_IOݢ,cќ'zZwgAsPW.z#9(7+Aܙ)Z", R9F 8;El:^w`ϬՊ(3P`cygfAg:?/Bב8)>ʢj |Sǥ4u3 V߼2;Z;A} +Xngq uAgX׷Bn2Y@&x1cBFl~A(of+pyb^>0r!D h$U]>ƚtf?Y `˅G ʜ…gt~͎hɍ:Ff:d `#F: zv-ĩ s6m.F:LR"BxV쀍"-Ź K~lQQ̝`~T-0HƝg)a;B7r5(k-$r yn˃xrl!v\pP'8I JN~yt}rt?,sQ>kork;-įH*n%Scr=#lcͽz\t2i5~"Z!4^/- Y7;1گ?Ay<=Lr'Yh%~++3]\!XwF~5l iy$6B-~,hv5Qƾ'Q.jcYP:~_C"NԋKS8:'ve;h"`!`rĖ:ybλ@ͧbuSo}]]رQ,|/طnm -6%⹆^ U.p1>hSep9H-t)P #Y򆇵Ѳt)D¹ b|nJ9CuJmq񮝺{m2 |q5߱-sl##1"*e?Όi`.@F+Q"I+ql1Rj֜`]Dݕ2iaǥVƘ'+Ԭ$oҚ@+E M2f U͈$|%yTNJr8~ð2A?NDd8;`W=A= +<kP1l s,*KiJ6L T۷rN!Q/<'& N8꿈6+7NWXD r|tޟCFSC ?BodkˌE!^~dz K3dAAxZTi&{Z8(IB?OU26* #';tj}.$Yp+|NG$kb/͛mVfզ~9 wb:@ax }9@Jop"F> " j"#kةsɆHՒFB _ف 0d 2@RpNA< sZɊ%\ 4/jekjTQtX8uNr+emD(;!G > t iE{x}fҕ>l i5MGCSr ͸{!k7*rgb;U=TáN牆4&9=hUOQO{QL}'B4F]e =Bbu-^>2VpܵP-91ap*kNJ[jxp T|?PV);vZzhP*3q? 9Ӑk"8Ũכ9 I` bwS@R1@22) ?~e!ө6^Kr.1LaN7yԷO;ZC..=| `&]% Hd烐w4ɰ'-fNHyeϽ/_/{$fs#{o륓\wEחp SxͲK:ϗYMҐP6j&*?4bKP" }J~c \h_W4Ci `G*>)H01@]0ܡ6|ƫHpn`Msg* `fln ԛvRQH9t-_Ohe?.c>s-蔓ގ^¾@ HD;>i(s:-ϫYE'ZfSDO E֗h^yǘO1"Jr v&&D*y\I 3g\xe_dw!S+Stx2j$9obYRߣnQN罿2yP*骛B-0_?a[Έj/x"sL0%PK ;ON FL은]uNcmڲ51F3“r4*`GP(Z ty4ͤ@qrIDfH⅙u^VB. >pb:𕮶:QSRr$ёȟRk.u&ܪ4CVAJM^5Qd t!^f݄ROՉWG1':5>:%^fm6kw72bXP9h9L,ßivoz v,&CZu׏7]:% [bZM4T(j5hU]&;7f3IS.r0.?}Utz8uh;eZdD kiKZU8 F MV ze>k7s7hG#"_JyF5K^BoQWJ r|WAL`r 3xj#n4CRCy}8%L~ x7 _|Au,Wz#''^2!Udàsqݝ-L\ BżMiwV,Y"SBi)an-'N9OhCcE1?0_mhSbbS &V;Q_,OD|s,3?Dc$mƊji-j>tzCtXqXKNC­[FPA#r]x'懱_Yϒ7uWL|g!c7kc3cO2pjՅя#-xplD~\|x2\e_qŞeH$^;: K% f m>2}p>q9!o-Pk U#eEE]l\(ڹyu/?ȹ+;MՉ'IG_ 9 Bfjl?y68HuerY YAGQ!O^?WvG?q|Л&*e210[,]x :ŕ26n[3J@^Mqa?/uuĢ[:0r3IΨt(t{RXŚ~`K߶#O3;Qt=?t=q7R  ݀"=#txf[u,z6$m  R>bhVi+͕$ PɴO12pkPh[>qɛ##o)  C"R UyN >p7`^`WeCΫ=ClKNB)éAB֯ԩ<$Xh0KI_**;h/g/ vZr^Oo4TT"4 ?:zm7ԶVTzǨ_ @ u:' tM0o?? ƱybyX^@e>[Xjas$礟0$'0*il.M :c{@٘\od`'xLґP`eyx8`ќ3>\5JE=KID%u>'\P΄}ʵ1UVД[8ԑ@Zb'0'"9/sawGlYiPC4opHSQ֦@"{~l},J̉} \Fwe,(IT1KDytRxc fAzDڛyP%A,9Ë/Œ}-o7[;\c ;G&x3G+٪%6$ș'v"lݑDAGhk,ل.SrÇ Xwel0LW}H{5nÙ=j`DC !BZVTo@Y4eds>ÙϣUT։()7*7 I {@2ԗBm-& َ UceoxW _" F9uc;1$+h ;6s` bzo$d͌ՠ@ZZ4`ZصfI~gE8ÐB5#-'Dh𱚘R-Fh$М\&̸zzf,@Kvݤ7 JՉV׭։ elPjpXdg'YDL(*T- wkźT:5,W\r =#oNS.V&'u^bx0׸;~R$u!6p$sr~ z&y e6,xVfߓ11]r(M<(X)5|}wXb2J$xްXvњ G0__VQzfU}X0:.OlSP_ʯQ׉aY V^N"a#+؊b>Hۉ؆_ j0mWX %"-d"j ǚ"5HnuJ5K0׾:1}itRjLѮ&yI'lno"OBp)~|b+|VhI5Ɓnf(wEft; 0PE`&$6Y6J׻x^<}]z $Ԑ&]Bk?7YC@SqVݙy[b6X,2,b^ >$}-͞ b-Ym˗6p,^OO>gn5w0k&DHuz`7^@^@qR6|U$ v/ :=  alx((ey V]:C-H(RPW;׼ltqGYWS2{:e${tH2jF2%S*N=X(c' pZ rMG+d.&Mr!Sʢd܄gD~pډ9b#ۓ/(>H#']Iަ ߊӦa=9v}jB"xr8z"~W$fʈzE=ً{Veub2#X8AGX,gHֆP,qoػwL̦3NMq2\FtW> abN D9dl`*{tho ?fa=æt x[Is#܀ǭ+})?{!*T\(Y FNUϹN=tv&5 "uݎ34sŜ$&Cv%{0l*?hӇqU< !#DJΉxS̬R=^|g > 4-)Dif Kbx CRi޴ߐCzpcquhj5:jMR9< 4o [R j5TY=x?یbl3\p;wZׯ*KsLqٍc1!{-~ Ƚ@DQ0*=K^}=u L8>vL$CORR-S(Da~5:V/ʨ*|,T D{KPp't~UP5eI ᘘTrW,nUV1ͷ7deOd+1T~1%Ӧhy9}x O:Jke5B{=h!Rʌvpwu~䦓5rXCuB<M7b' @w‰- ҴLlQu~D  $i f$xl@_D s@S1eB/4m>]F*=Y@tQ {/5iCS;5=L+ް3&P,^L[N!67U?\ _j4?1WWP*ҢEXt2P} @ ѥ#E.I۵X̝UE;H^_arb0Ʉ9;;ܥ^v.h1{o~)W&6a{OD#SIdN+ӽ6>Tl>ߊ3r6P!]n幛kDGĤkkŁ QɅ@1YIJ Tt ,;Uxti+JϿ;sP cV4)e\rYn~Ѝik,w{/Zi Do$?AD|E114.c#}6bG tF 4ȣSbh4zA Hʩ`,DS|7\燬Xd}7mPA =L=n7WTUz *H:>mLC>pXsbi$MuБD7mǽSھmB4I\^7ؿ>ߓz-.?eO֏sfJvEVƶ9X^|g#G~,j}X?NB]5y#~2"Ew?]!c[DvC-h `9_rɽ=U AHk 3*Hc:?}Y>ԵI5臃́eKRLu&8QD֣X{7KaK^H'&{ǡ_fDV[:cb(:Xx䧪)9&!%bK¬Jm0 8 N1<@~dt^۪..n"z> uߓ#|in1v$8}0x)q[̽WP@M}N/E"#l1A'f0~7 ,Nh&μIŇ9ƚv{㥀%CUh2m[xLs])Ug$'{G $K۶wy !qLɲfAtDcx*<勖ixwLk`I<>@NWQךƪd&֐mQNB, K5a2@1P}BLuy"4Hʠ4a:Xl @-hŕcWÚJ#cҒjr,aM5AĸF?82HxOXAg<+`΢ZH7;g5nDfO~uY gw>M&T0}i:Ӊ u#DeO!mnfhzqV?>^޵"o=%v3/L&ÚJQ3 ^A#5ӄjSI:0\0 (SV\g&g{mFO4$^w3^ z4]n*غT6wp4';ݾ2"[ʱB#ʓ`v8Ka$݈#*ZBc+9k!BCf wunK}hQsMg4H$ZqU5%=\즯Ob'B<2? l3/;k>qhMb,cYd4 WMXr] KW$:2 rRף{†Wma;P Ծb@f3dKCs3b0dXE M*YcU-0CNF/H6Qh0F [aun'U,9cu3iFnថ4{wFۢw`8B3؊A{B>S ReKQtDx5Nb9BU"GUQk0E'ΰfĘ Q aba W** cOQR-|yp\%6 t yRȔ#}~X(Wˆ.hNE^qn#݊FΩ/+>fg$$0B垞)cf^b|j4[ik;OplyAH'`-XNڙf(6 BZ":`F0Sdc^%0{Hhp%oRACm 5;iSUaLJn m#%6IUbT\" 3bɧYxGkHUg[VUWgX1vT</@/u!/Su9i2FlYzP`_&ukXle$.]&ߜ˕uKc|i[H̹Yil7~`Z%KOH>]vjT &R5땇, H(Z&YqAÙp=DLaM9tϞr3/&1b1Ū\79~ho2SxXz]'41\yEhߞ2c70JS!KI4sIj;j;0$C]ط66p-yO0N"A;`PLPExOd#>KPQB \ o2%Rd5i1Ch$Qj_~F#)@x:fe(E[1Hff1TnL:I"ײʏ$!sihI⚺&NrĒE/MLlƑhI#RYv}lޞH ҹжn <gǵZFgFkx,lkKٕև"xz I:j0R0낓q1QN?xKn*> –AR.ȬkwhJwwֻWܠuaW{E ^]~ YVGSiTGU8PøJs=+t­{ C3Jw Q09,a<z{$.\b-VqWu#\ 6op.fp] @d)pAORSH*&F[7 LEz&m[#8wWT ]oanX}&6a$1O{®餍.tmmwzd&krzNECQ{-wj 3L5\xg¥\ 'b?r%2~x*H.B49j(e&78{YG6Q 2upk^"܆<~۰al]Ֆ9fSwGmK7QYf{ͷZch2JŦũS+*LhF ` )9z#ɑ`@!/hu Vy'ew/3KT<]19Z3PgHR_AƬƻ'=N#fowVdj]nMۦԍݽB< \zH%</sfRÙ̐^/რjv3}ѩE0"?Τ@w^அs |Z^,+VeY3xtT@V0V ڒi {7[ Q^(m}EcF@30+?U'GSvW]~V1\uǯ>{֭&QtXuˠZ8D^ &/vÜ=#$(x{n1ץX|^)[v*70R"줈FkSv6u_0nc+i萵[|kHLMgIar}b>_[(bՂՁslڸ4Du:p[EnߧW{ɂYFk/*.,0ӡs+>YkFFcoO_\uRWa0ӎxYP%G41 Q$U>HbYlD;{Z&R1ewUc%mx6(i^[[}LHHJ .7*:Mot=VR1ʹ^[l֢.#aWXS4GP0omW W@i@!Z5?G\d`@➮c.r6t_!u^%(K^ì ]A[C$y/Ynqi!{} a=2ߙ]$ {Nl98(DK[%6Mfդ׻fp 3t"j3;%iاXrXfkNrz|;K~wiF\Wvgc]t?4E&u Y4`wa[⦐COF,yHy mمWހO,.nE.ph '75*0&M&^ A. Wpnrv*Œ_qmXA+P/lfn(vDlO+1kM1I{K*~9H##Lp n:q+孫N*_IpuK`@dq},%]j maN>7U5vϹ͌'@aOlmKgKb6X)^' ltft/4 T2*]`;mxC `UOF<џFu p9?8i/>\N`%g/'\\uRVP;h\)4G%VD-^L?brN!rn}9LHgb]x .4\{Bf}tGb5j.AkCbo~b&p{Ǡ$ rBpM/l[B%sӟ+J9Wd脿^a۬VC9\ .'%]a;a T#+|= Vp-ay"?'&r$9u66 z/;h~^b@5;r=-hs&4t:JU\1\<Śt18o t'# $WA JtN$YbTڶ{3 , =ZyH+ cIv1D`J G@"[V2yIDHRI, UD(}UcPL9^Oc ʎ9sM/(P:4a9c!ا]8Ff.r+3505pg# $+Ѓ>ʳ$.qv-H@[$)*\"\H 'dj]s$__?"?ɡjn0EOXƘjbym!|i\*]UO[+Dxw$8 ÏHUf.C9=S<4):09mM׀EV#;AZm7) #NW37"UE *ge*(;0*!8$fS&}N+@?-FoGne̤&10Sݍ3o޿]WP`q3.GP0  Cf<ЌsRui-B` -7=洯`A9Z>7TM ߗ/n_^ +N!Ep+4r&s7))Z d"F+}z%G o?jK 6{K E|x ]0 - < FPl i``{*nVI1҆ꋥ/yd{Fhy(KtZ )zizRo%JϜP9nʘӘ&7e SA I )zNefЪj-WcƱzW:Ҿ^nMڢPK7x( , Q0 Qen.)lqZ n{ tIJFglknT")]T}j܀yo~tMJҫYɵk "[/$/[^һ+(0`Œ,b -`߂Ƀf+X2tQ ӂL:3;fTɸwC?n>~A?j.h4nGT.m0Β5O> p䣖r:%*/?j$ӼՂ+ W)b\Jr+W:]}uuJU+WnWMr4eRJTgl/)Vd?mCců`OMxŖtg^t(BP ef5zLp4?FkCkMڛ؛6r(luc_'NA>yҟC+ChQ‘#fF/ٰ2r(o@|o<p @.l,A+ ϼBL2gd [ߓOkD&hp OR93*Ux{~ &q0i 38 Zu0s;f:qPм 8ϜLgu(U:tR(1zU€LJM)"Cj6 0ƤG~U&-q[1xsGx#nS@; b?*T`w)ԯ-*k C6zMJ:5stԹcsVB$8-HuJWy)4K2'Z`ZZ?zāJݤZJEJ+T\))RT\k1o"F,'6\p#*NU9EAG 96$at/[tnpt q?~X1}L!Cȼaw'-#e>9LE?qK T_)ĦMm*!T!R&GSyUWnjU+EX@KEV *A *ߐnNMkpւG9 Qj0(7gX9TНbȤ<*|ɫWeqi'Jx+\AԶA tfv h^hr:P;y(aȅr<~ ._Bxm.ފ(qPBЉc=Fܷeg9b94Bo2kD]Cw4Um7ni&J7nC؆w7lA& P .-wҎ ^x܂,5Q Ħm([+c䎡j;Uk\uZo[jM~hZ!31Sןe͞6} lYaM+k&Sy9uN`|Կ˳O]88n fG/V]ݲ|ӿ-Iy>4ēi"Oz5O\Ǥ'PC$\;6/>{m>'}IkU S I'TEHۘds B}.MW>Ɩ:v#б!fB5 Rg%M6wuIM`NXtKY7]QW X?x6P6&eI*wT?+ѝ,`(rQ]BT^efoGչVh#GGŻ%O,%`)/$_k;RaZB:,ubq3AdSQ:>r:QWNA]`n.r)Iuxr1{">*83X-#C}4]/F'NN=6.=}{Jέ-wgSuXB}yKp"DC! 6 irɍ/Qt`w2e-)T'C)SYS¦8OcmIGmVNژڷ~/ f5&BgdsK=R"dAҍ~0ITGVoILO $4tJ{%$7)eG܈c[mk)G+꠷~t I6|xwQkrAdO~|!@D;H^" #^`~zp)Xs/0R,/k︌6$u ߲>I˳?nЙ\:Z}-p!*Cmfs"EqqZ9r6h546BV>.HII$~`GWPU6 Ju\Nʘ'9ܜ9c$ͬl?GWRtD![e;2fɜ kSHLJL9IZ須MRJJUsRVZml\CU,R͞,uT[]Ks/w/^ Lp"ѸeOşsiC_y$;ru )ڊ4QTT8K`CX lĤdoObt٩"(k^!G=H/.~JV7ՇΏꦖ""ۃ UAR j"R,L$y gCU6u^|tC {qT)V[_U&rpj*XXB?Cń1/I/(kﰰCӶRn!v3bj Ƙ%VO ~(P*az;v2їHgӰmRFbdښUSDMǏn1e:X} *7m2ᅴXC"&N7V/G#TGݎ\IR &Vk:rYo^:ƹ׎& UKaVJcMroω3Njf?}2PoQ0jsiR7.]lKbl 8Wȝ鞎?=R *n$gG+W=Q:X) ?4 h/C(,UX3h3t >~Qo q  J7ĩ-nv*DZ\ɏ)RX|MSi*P%7Oo@c2[]\^r6Ai%lB9 _9}ϵV$yAN9BnjX4R+c"0/&i f0{1wW F om3.@mhɹ "@dWٻ~FݏJ1SjS\@r=u.i/U%Uu}Uق1X[tFcG<7mEP=Hos'OE5lhmq°jO? z4kzbM1?Af^2nn\N;N;w؏yr(|$KPVjE6UxIn'%[5Z5lZ˜m]gs~8&6zl=O499` jhUO9@}q ڛ"8;݄8 ݨ QxB[9Tsڧ$|뤝do*E&Ll/(Qjz[*VK :$P*7~jƥhZ\ #K[JK9{1w>7lV%NJ*0ڂ芍dRmЯM!B߀I4'{S`u~T zeldrͽˆ/U%*/8]0H-SǶ74mYBHW"ӡ#KSb1Yh {sGx;,Yu";|JIӡϒJGۻ'|sh%l`h{)V V'gLaGH҂r]%\}Oa'S{'D ݍkk_$`z Bwx 7*eVގ\S7 ~5Dq[M6$mdT9#eanjFuu|-ZS[Xa2-h`uK3[Q[QGf3"_!Q!`͇#EYF͘u:/6m<{"FZ'+Z7T+}LLퟙXx,B gf@aR O\f7/WDJ@n?Mas΀@cY<=|MvSkK )Q%cW1^Q$gS SU2iGl?'76f171 ISD8=nhjjZ[O2ii\+T8p~{;6\GXߨQ_a.N{3#e{ON0e آ8%?8A Je|,wnr= \ezk>ke( @&muќu˗6"phR;MyJV u2bIB5QuB¡Y^藅cuZN1r 1Π*^wh:ݒ~9EgCrO#uS9Sݗu҃#*o7u]UP" :욛D"#H|QbKu|s?5Wv@/3ET~b,T~Eu3EtMeN}wi3Ȅb3EoëN$PED׏U:Tug{[Fԕ\t@&m~Y;VZ1L[,6/ sg,eKTGYG0_8RE'm1*k踐z# l8GO8zxT7)[ۓ#lg`4ZD`F76>|YcjTh>=V$򏸭aty8Pr!`uUb=zi`[*S2peއ:}D/0N<2@U}ӟH`5 C=&3gY0XM;VJ +[Á.h5jwY20|ZhpP]Fc_'S]?}S 2MUB'L< GX'K*?,Fݒkt?V?w4+T5gGC%bX3nE *H_Lۚ6m\Sl7?"6ITw*lۧZb Լ͸im[0&YP0rF:&4T1nYtu_;' N3XȔsLYmVXaoرE\gcXm((7P掄f b"U:^.RFNfvGHk Dhe-CN#~ |e34QM>۷K 2_:[:-?9DixEF"t*s}""3i^C ǣΦ-ޕh\% r<K/[۽c.V-ѺP|~77l]Y?S=k鬊G;h1 lU}K7*{; /sKrJ7H7o+pJZeJə 6sV7u=h㓹pyXǼS??، 5rGnG5=QOdCz<3Yc&>ܻTo ʆ{˒ (y-' E؏}iXϞ+ VXHHw2GEbR\ )X' Q^|). x7>+I* }v1H^MxqV$POњb$sP&fEUL0#sq\xמ|&fP#Fl nA_m>jT[)m FÙ=j@4] ]+4Y8OfJV6aO]'D$>Yֈ/KL!G6*RV܁{n)k&TFQ(cXʗ8Ψ6H1\T,9ޡsWfX_7,&ʀZB$}^%&tوlj Z$WpU8WDM'3`HZ#FU)6Sƻanf*Mo{\2Xms/ސ͜jLlmy۹Z 'iw!b~rmV|2Wry2!#\U,kzI+' ^k9?H4ձ(LW /6Z8q&! S}n`moهѝ9u':*\*X_=Qq8'p:PE@hJfGIYqm-*^TtMXߩ Lն&h=PG@=%~xHEڼG*{ }NiT^QU ڊ:ú.[n7Ği;dLjR%%Ȓq`VMiƽj&Kj^@:d{HJ7X)k~Yٱ8e+"kƏL܌[Q'VYRD+pk.|/ f^ގ2v hIޘyIRz fit&wV8t-sٍiI|Vg;K+B+3k;"Y;pMZ@vbgZ_ѭ%M"(kOm1YNp7!ZgR:-t,UOŲc/IĉW&p"srb# /6wDub4 q%Ѵ־ll2̰mt7Pb3_$^bgap="&rSۅ}BWXWHcb|/DBљs2߭rl&c-$'->O֐D RwjL %8,k{kư5|ڧ݁3ij}lS$  9$""W/A4đ|u( _^{L1W欙a&fjћ[SoHK6ek>:MG\wjtL@%lUX5+ ,+ۛiS] -G]\<ɥ" O,fblOYUX%q eͳHbݕ)Qn&]$ȔZfP-FC6c#@jG; g%43X]/ap2'>u(0;{fD\nwԖ .j]8LNCm5ve+dH島Y%FajQ fln (n!˖`1s;ҧk;'"6Tu)`M4/Y{{w#&SOL+>&ؐRFՃE*kcd<`_Ӎr3FsEJ\(#jU&Egq 7di}y6DlA"}qgV5NBE0ZZThE%bzp~֟%\nl;;MSCFo,EY'Cj cdfs.sysu˸E["Sp$oԝ+pi3fZ2/b(ݳ mdl{c0H)@(0a}^z^哿7u'l%kV_9)*绹X=4!jЧ)vϭo,-jTWPfe-gxk X1@oV ✐ ,i{ EL; CvY3z;Pb*;1j*@HP@. 7c(P N9eW[r lpvQb5Is F +3Z?㬠j ]@Q`VK":?Зi h,\y<.lOJQFlxUnd.a=1f.9+ Wط#/ﻟ|_o)anAωs{p$n0 tS5*c0 BUGN8ڕ?ٶ{ B|?-^ "c[93Eʭs#Y"V^ G@-͐ "lG(CcYTUGG-PD6> Cr '8m:1 ȂABDҌ(S&k>g8Gf4rP GKTXG@X|TyHN|t,)"Q+,J^DY0"@Z5LBLkr5 (=etxa}z=IGuZGBIx;JTQ`E;`M`u`L)_<,Gi : WnxHaL߅ Htc7s15cS%hCL&˙ S炵r%1 \-OpyJU5Ci= =y(vS.s}ࣺiFw kRnZDٳw&\q];t#W\`izvKLEĜbdy @W\M@z(5<ߪ_+vAOn9xs0֠$pl3qۮ9JL;u9`t&Xg]9{V Q+c*ٝCo: 0n2arV[N96sD21Z@xp\%WoxFBܗrCIƆA=#D]@} žCc}U[ڿwkD".MyžT=NVG[zŨ,ڹ9´#MH + ~PO;4&bBl!,0@(=5]sE X&rP~({")(?.ôm2Si-2>bV@V|7{P A0eLVͨ7q|C͓d*woSLV GMt`^ TSZ=UNO X>W\9e8CѓKL2gQF7z-vYϛ 2z%.zT\3~Q"~lр+wtѸC,K+anF&BA|jA7! rJAՔjvKmqUν'|tvoElq0 | $)λyuڛ[1[  sS ~~6x8k .G'a5 )oZ8p%=1P1J@N^j,ƪ)oRH>@-8f:(&)a>LL V¶- ʣf?\>۪Ej"_y!Kh,FF/"x}d&rФ^OM. 9S/o joic>Ï!yD"e2l슫i҈L42k)j4.c,cnx\L"Dfugf,gQrsfT]Y$vDܲ @-! #e$F7R;^: @95o9j~ut/dإ1rDhmQ]+Vb?g!Mw#\ k7RAav4&t-co}A<rp)V81LX5͎T,4$ƺ\GqjMVJ[n k1Qd~#L,54#;/͂2oQt8^C[Cz`Y&( #T1h~ʤKf.\GWgUgY4 nMƳ7.l+i3tY4+D}s|"Z'jr8Hyv'WV*{ TUrpF#5Hɳ?Y2K(K Szh 6R:5WG"G)𨵦Skpݽ׾_]ǿ0SX%DHIwzLMUՓe8ŵ] ܗą5 }˙C:U2n5DZ\J`э|&$Zk{|RV 2UiAM4g-&\{Aک1) =zR;[l$unhe wvB}ɍb#mI~`Ҝ7f?T˻}2/_\!Uf'aq;VK?$$$,8kбaf>['P/ھ̹(X Ø['jMOYgܷx#d,;o䖍έ)Ђ3R5{ тҙ~.GdLOw"(|r@糮X(D9 M:_[58:dŏ^䃖M <@fV~P6J5Az֮!tvi|8<ސ;ٱss斃F+gqYژѣHlTvD@3pOp3bok}răbR;)Qִu0Sb>OAv"f3C3o{-n{ Ab-(B]}nf207q⾹iDX``-R}}Dm5(j6k]~6&;zH¬kd=Q0ھ8!JGE(8k'ƵIw-vR;m``nR,ǞYTw`x'RL,p)6䌨,bmowG :u{ 8y!drԢ̟r+8vp$@ tKd܃:B8cv,ΰחl+Z8)KèX"e'ʪj%&5ƤYCt +` 0/n2YGE"qM[WzO3s(%A.8l|Wn󈪈<}(f~[j _ Y$mHlR7E[lzRXS+9gWaB}EDuf_ ٓMbxiu9T.n} &֎ 扗2.?(E<} fmғXr05kɫ"WM5^!do,.yӄMVNkcQbA QL^{T+G(M:C%|H^yJu+<&f u`r9nԮ9B9Ǝ>?KC),#ZU͞g &|NvS29xž gF$\u)^FyRs}p}a>W~`1IUi&5CoHb@zk@qٔ!eHƔ\N/G学Y]CTm&4>n@YV_˱\4}zξAg/ܧ*팭AZJ#R,V6qs k{-|,G,C̓C zQx u#\? d2yCh[֨{wrnKbޏ@@|'Ɲ=G2.!¦Nx2Fq]>VG}u ޡqkHL`F|&ݞ95Gc2ͮu'K:֋Ia}3^/0Y{O:/\?IdHQSeS8ݗ@.'b{zw52gF\;#x"89D^E.idI]W"x ?u.LG)9s/:<;;)!RBzFNޫEpݓHYuLa/ȶ.R^;uN1: ].JNش,P0R"dѹmejkbT#7ɔEgޏ9i%2{r{E&үX- 1/m-xEI/<,Mq ُ~=@\Sth2 |*^)wxe/wCt}y9?hN8Y1f [;z{4=-1|VKck{CP,4:p;v}x#& X^K/l猶<;#F$Fgt =خLMmL|K}{@7AФLLAQ=fQp:b ,L7xКKp?+*<-|qx2$A0e$Vˍ;BT A8(&uy?%^)a=K7G l9R^8jn/;syW kb߫|᫸#:HxoPKb h$wˇ |k0_ {.Glfyf`U$'b {_料@ QWzPiyصqw~̌D`U9O;6&h~dwY*eO5-scEO oecx݄7Yfs 9N^/o,jimOpKT爡*?EnyϚ;3eYNdeǗaP9z>RuCY@ŷPkƔݧ8ߚLFa,VkI&$rsk_/-īA vGxY[f頡IAF`q|p"1HJ1HqbwYr^|XC'[PPod@Xrfx[l(/Vc +},"V`->ŽެZ"9 KP@+v_ p`<Ϯވ |`dXAPn8tv|n3hg\Rt>!`$غ:;!%'v)u.gӳ^!}JL"_id{gf9Y[(92~cՅ$q fG,=Dnz?>Fk y7 rƥYJٮ 6R>9)j"²9G攌 Nv*Ӡ,X'֍i[eeoiߗ[&$jչdjR*>MT`OA=wK;IuGc,5g Kådž,~PKnW"G# g-N:┹D;}PQJi ´/ƌ,/2XFZ'op Od)$$T[HTL\7 S^NDj>|y-YdJ3'3"ݡD8Q\ HAŦDp{lV |L}$*v,Ha02R]8Ccs^S?P݀ R~pBJ8*30F?W8 J9?d9UJU'$B׽@x10Nu }ZzDAY2O\UNISsمX/I`X1UA0. Ƶb@5fGW}Ltur$JDkOH m@v)p=H )PШ+]o1Nj{~)j[x0@p RўMUH;y[8gg5EɅ2ap16_ J=li9>1mǗN8I?{CcB YDx}NdBD̵y)fζJ:p2K>8|Y-q/JKSww2C눓*t)yai‘ΚNv@v"dR=;sCY=˗vn篰xvֆyYHo>P 6x%0*5/P ڦ%Ub˳>|ᅏg)_4gqFe%sp)G0,7b@A?N֛&{dӗw,DTNʷ]oSYAʺ'՟GW3%FF>Mܑ< $VKD?2@Iķ=#?-hMNg_*[ȷw‰C"e1,%xT msp;R^lKx[, ]2sZnK#qkydH"Gv~S7s޴;9kP[OMݨ86Z#T\C?588 4NTRB,$أ7i^P *SAVliUp^M >q.0nC5=דjJ̝>lJ@oadV0!|nl'>^OFgG)]O9 P8vyr\>G\K3vv;>:wy*G$ގW-=U"s^*;XXYYQفJ|&k :]Ƚ| 1t/'3 m/AQa*|y@D&~DűIdc,e_ң՚[9TiZ FX,w3CO+A+1i c@۸뾹S`Ƥr0w Q&7ԖW#ڏx`rfq0RtsxU3B|uX\<.ӂ yM &%3l^Pj9ͧnE8=> !@I8>G4ꖨo5G9jӨR,BXbn*;:&D)yꍄrP"jЭsTNVQt$E^:MOz%heE-Fo7ojG.@$$ng@B[Q*n&6xF[&z9BՕ\0R- j;H8*2PPZ0"34o}7$ b&[ <(GjRqalMpD']f\ϹZ0>n\<Qaf5Mpxtàd_kzLPL1ҪcN:c_G[1Œ-( ?wA'a~kx@QE. .TϦC(p1Ncڥ yݠz"  ܨBpyA8@X ?Eb6e9y42q8hޔ2PO,lZ8D9}5d@utgHߴ>QN)`V,%_qd Iψk멇fDؓ33!a th(XFR7JcWX9zCdlp")(kU/e[\[вDXa mL(vF]wr C>3~H$f +xdM qu:wHP<2iԄ3U u|Mm;QLcܵZ%ꄡ(L+`Gញ%yy&< W;[xeHs:{+G$ӉDӻ|4mgQ?*'] D]iQ^ *CGa{>bz!`g ^#p닡`xȦ+[(eɷgGJy~%7Ƀ0\YuPQYp^jLdp>E.h,ۏN1 %ސ\g/D[jDZH*m) eFLFw7Y|V7`tu:Y|c9AvPODLC_F1l~Oi }&@KZ-G¨c Sz܎.nKQ<]6QJO(Sy p b}&L !2NK U6S2Dʓ6-/?xq5TzZ2|nt{DHhiK GhqdN)"lmГO.me_Dgg|MD% ?.Y!c޸L$x;Fba\eO{2w1o['?enHWx$HInʭy΃x@ؐURh?ӐdMo3E1\~e`)lw:w;}xAߞsK{soT|"jP~$X32k4켎f=:qEd+X!(g1XQSX;lPũ{~y͏/t17r_`Y#a oD͟(Nu= vah7U>ElrcZڝybjB@"xl ٌ`ix&+KXZ^ޡ+(b֛ˁ,D*(0#o+:6>RLde:o%Nb%ПprtCx d^:5 HMODteԊze 3VgŦo` an*0f oտV`{oɺ2 eB&l=nڠ̮$oT#4ooل|#fCmfcT'B #o(Lb$:MW_oԌUx$O ڙ)p!y-jG2I olD8,A2ʨ\1v5mNKiU`ia{}dG3*F͝9Y6Yz&ETȠ^*i9>NK&i\=`%}i.sL7x2~q ; ڥt~Ay= %R gtonI>%k0QAw:"AAsj|gnSܣD*n00 _' ZTLW>"ܺS:3[dl۰XQ%KKV^(`i7IvhD D2Xl.b]ܲͅSXRVc2i"(,;;(wBaqT4Dl˪w;rΪD[BKc͋c_ A3.o{!O''Q 0x+K8߾jj BrČu'Ix" ;"| (rc_aG)e~jԍzvmp~&|13G؀wASnCh9;ch!|@,y]↑ᐖSVDvRY"go hR3ws9}ng_P~rQ*Dy1nfwjB7=k?*x J{ux 'fz~D™nwB$z^S{#:両e4//-?R!N 5xUC1JHsdقz-I/d=EEg^$Lŋsk.[Iccզgw[AC@=`wCPrqݮQF7NL? + ca?2ڡ@18ypVch#T/NJXQ>G8;./ܐM3X0|73on9bYXֺ@lj9ƁmDvʑ[)x7"ˬA^ 40â>>O٭:EuBK rK#%sMOZ4M%AީGj2|*L'@8)<[ڋz8W}WAS? 4mV3gmɳ'8R ;!LR']I)T{UCj}xz k[-+UrNv8iV7o3pӴr9\WM0K0P΀7:tq;yh+BB!+#aa)8ͩ.VtSP0zߩugnM{X-,%MtjiYeNX:HY=ZgniAQ7(F4xHU}nC3drwǛ)%6^k=[䫜 .fی%5Ɇy,NṛkaZeOE& geh|@ezJ`ZPfK^?^.PUY3WCkdu0]毼+KЃ4Plo؜mO"fYiMr;`>R& x΢K廘(%^'u~Av (DQ` y[)xGc_$t_$8 B6zh %; 9\%p4<͕#5a,;w?#[ėK=eZH:gq}5/8_M`Ds>c3F?(2]9WRqRYF < RжZs dri b&@j=o{C&ז}5&Uȩ͵.Y>ܩZtleiO|#xpY ~oN^)&k_(h-l/$XHld 5l)J+hPi׎˜Cn=9Bhjt~j0T^(ړ2 }$SG%HG\A}(fBr6ǭ?N%R6r:4TVLp RӦQx^_r"3Jh?.kW.ϴXcidh(oW- |YHWxer f$ޑ}봕M1w'SLފ}{}6să.P@-zb<-&\&c=li@1p9bܶPݍߢц\u-뻠B^y77X 4{}RkmqR'?])kV^[\l;%B;Wd &OXC3@챼sS|.|Vn!g,{c޳kcy5͟Usp UX3d< tʦ)bfW:7z؞bqn[h\^Hx4'v ^$Ο]6HSa \ Xv{u(ː_?O\%ʢz>k\\%C6Cz ph$]QyjSj'mtt E<7zD~~y~Ak~/5 X*n$+A:5%" ;fEIӼPr@\ߊ;N(mI4pIy.8&FPE rHAIә? Ω^y[\iCב&z1/k~Z`I_ϳ 4jHl(Xv&mϨ-BcSĴ+5灈ESYu^PVJ%$ G&1w2G:nRr&"һL>=޽ "Yl-@39M3]hINg@8hqU 'P =@A'6p 7){Xo%]"$LZac R3*.0K|E}Eۃ=gWo{r+ €.̅ O#L ^OؗpVx=Yƒx~%UFj@b5sQ f>*|dg3"jԡs*8W1…iәz4Eg;>$8A!C[^q9B;J4o־Vd졘 vuRn)h1{@pqwC ,ϭVռ·^˾6eӅ=x~[-|+!4?  MjK syZ^ݛR y?p0܊sE6s 'V`<Yr3`sx'؟/4.P}Ԏ+uk;fⳀ0 bHw:3*QO$b#eoZX3vj9:}&ʍ A4f=ЩhM u/Āf4._,~+?r'?5? &g,R0ɓ)N%{\X>F6 Fo)0D ݡ^J-QeTt[G<(c/뜵tN%IM2I7tY*h{A=o'&Oh՘ڥF y؂㇈soXy̷pV! <(k ov<>;of3KdXl"@/L7o Mo6=)v 76 &7q䕿wm+SXܰq&8'pH&\DRmGl&p G TbQto}^qgdZz*@<"h]?8r'9;Lt` OV9p_홯$!|:]4CW yNeA\aWgzM Hx1cPG6eI"}F\Di$Rx P3'@GX;Ŋ=`B8u`{*cq  Tֱ JыòWZlbQxy Jw#O+XAG*!6|܌PR%/Qqx[I#4j$YTkmpIAY`&?^^7vC&A[VdxF銶9NEJP@PNQ>?>ŋ4o#vG|6 H,lK⦻2ȹqh[ !j1}X-LqGS4QXhq~l†Xw⟒1=!V@|"֜-L!̟8椅^ fZgǐ)o7BrSa{ c+NEe 14 D!PM-# 2;ԍϜ,o(L&%U&;JE<缵ȏu('zcT.hy1(!VaGm-F<",׀j<ӁgH'ږ7,ދ8z$Dmm|3[~jGxrnB\/2e`>Mrgze􌡀>6kaE؞ mu@2̒cֲht,4$gx9`<^&8(65Q<)s <%Y8h: # ӂDt"X .C)0O,Eэv8тXDN@7$ɕL,L>Mej{!3yiԀ4 Q\X66 żͧk7WڡOtf`=2DVS+O֝H')Mh G'2x[yZko Cl>wS5Tmy"9I=)+%Qyj?pBZQ2 Amȼuej*д3=0?t (:uìQzӬ} Pbњ?Lf#qm6}5>E/PmY;{xf{+~f8z-y&h+)LQNq/A3Z/Z`D .&~. ja=a}Ryp(sn%jcԟٵ8D((&!n*󢟆Fyиiz't+ ߦ}Gk0tΌޢG&KB8PZFUA ̙TOkCù*R(={S\4$("bSw}֠8 qCԻrf="Hz Eҋ!,Tx^Ӽ]7h_4+e| t%PY]JΒ/Dq pJLaKq. 1lOWv`V7Sy/( zsЋJ8,D)FlS}w^Q%Ac=6w Y M8=f;o^3Wgj*B&7bT|"tb7O KKpx,mɖ\I> AP>W{UWܖz lJPb3H᧡;Nza[EerߨzPgSO'->RE?ڀ/+$x"сO:t/HZK]/˃\q1G r߇gNo,}һ I HNHW#,ߗ_ Zq~V?hM0~gaܐrZu-mUfi#_@Kܑ145Ieg3$wJ4T>;s{np;ig1ן3j{c]P}Je(whnIe|'k<n.3$K,xCJ'g?}-l=?v>KLx@n\W^V):yVEvp?bP?U ƐE$Ίi7ƛOiG>]?m2%_iV<@= ٛ3U}EfG ReU!~iA|=JN%ԊsjY'>tT ?=i^5Le'3eLs.mڐyX?Vt:'J5+0El|yQb0A@9Re*>jk>nٺ#3oǔ*ٕ'苀wByTHVG3s"\;/B^uJvZ4Ji=>|K^^NxxCI cLv0 oCQεm6e!yY-mr6i6fs흧I]rO|b?* C|UGHɉѡeSUѥX3Ko,(_U hyTVISeޯX R7 Y&7>aMK&i:3gmw#U_"T;σScڏ Yh4w߫/ub:(3Lг1Y6'Wq=,3ΚR~_8(z~;<Ӻ6_|Z|KH錒`Z?'guXه ϔx6R q8B8@kzxK#goYEO ݱHRX̯t"^)L^/aM7J|;&(֦$6y)GgM,rI2sE+Uͯ4k;V(B92 wc7s<Ҧԍ+K"$TP0.HooV|Gy՞!z]$"ߊ3bqaǹXb4Ǡg)wkmPԔeiL5VNM0  R_@8<"T"1U~R Qާ0gׅy[H5Oo2\4Za̙aVo?揉L@i*k%l HT9/ ŤRU0!jA[2ݦ9'Ea%C>RjqX|"y_Y9Ά^g+KJUz-sGNI$w `.`!OU e#9kwp{̠H;Kv\KO h|F;W@U}3<>#)'xV'\n/]TAApQaE?(&i 5dUig0pO|QfQ@1t~:<5bo"=Y%=ēqO]ɃC\x!667 aSe !~#;+<˶tx٢80u4ԛ4ڂ{zmtϸa3F)Ӕ.8U9 ^pM<0S2InㅝǟT{ 0p丌t9]0LMww+xNtiu-p}*tjtS#,$3g M:cҕSTcV@NLX:NژQ@YO_PbGI2WN^\ B&iZES2OLgy qc|4bjvfOェeQVnIȱʿ O![N 6Rѝ)˶f`n&7bBh y3ۥISHH&fbL4C#ԀLuZAHP5WvYRbwj =tl6מXqre~snNBXϙ+~@l#0B`"b(]:vU#Z#`AetL-  F0R1XGvEj#N!,UCV{JZ&C٪#j`u ׺ mAJ'/.|E|E"D`?Ҥ2'M$B|B@bPD( {,\a0vڣكGB5MƯ<;Ͼ CrJpg8]+l3gxmȃǎW1*[)v&C{+Y]RʭdHUlAWd{mb\eMz}IVgd?O4A*@qzCHfy#ݫ#Y/2:+mN-{u (Z2#i1"y35 ˾fɲ1Ïzwwe_JG% Յܵq{s*VJE0 xj&fxos;O6H3yd.ԤrWVn0dvЈ&2䁭}KvAKIpI'UNBںZ6mǦ4c&ݲclZFmoe }{2IFO ϱ:S{+ٴ +'x6ROKwF1$ٗi踿(ǯAl0BXċl,ۇ%_L>.74;l]Y hO$^NݳU6Wl\.SUHʊA7#|ʡfRhזc?H2LRəa B9\#GU"W@_OWd4XmCHy?k|BA6űZ:Q0P%br ZvOyID>6B3l9j'yUnӠ7_h՞ k ؕ(y @><-~U7bTIa0;y ;\Y6¡Q!O=E1YDZ-i>1(ŭfB&i \Gz!ruʭmU@/ϥN4/bYD`OI -CX&dP¥ٽ]aYivg'U^-eQX&Ri ӱ*6Tqa Czeem_zEQabٰجY--/-1V[Z[s#YTkm jRTI ҤbSjTݞS~jvԺjErj*JPqP*P**Y~ծBC VCCBVq|"ln_sWWו>*j"k*:loX*XYkcXKnk4꒫u[wվumAlYT䂈FFE‹Y\dnn\ȻHFj܂%:Z淹]..W˵rRT-u2TOu]uu;Nw=@#*ՕOxTPԽ/ BP C T*9)MPU^Wm`4#Vh+~*yԇ5gyYkkZ<%TkRZZWU[KcާT`#r#FWSPD\Z\he9šw.KvQRjUK-T R%WAP)Yj8T/J*PUՅuZuVƫ*SXk#RH] o:q8$ mYiZmq%Y4bq\mZou+JvzUboF[}C#\]* O Z+dFFŅbUIW7ߚZe;*DFMabX,>KgY~Yt-pXun*v+* k8ҋ"jcX.VtYf뵉V-~k"֎Yw5DRn ;OT, %KBSTmUPZdC 8GBATWW*7^,* (:ϊq4ť-٤Q}R5Z;L$+˕"'r]b+!v5V4Uꡊ$88JUF п&ceUUڪP!* [%ԤV}WUwһ*xUNUUyJQ! !I!M!Q*!\!T!V [BBCk26A7B|9(~MOhvԑǶi64V\MZ@ !L!This program cannot be run in DOS mode. $q5559׍1lԐ<5]45Rich5PELX *8  `` q@ [ d@.texto h.rdata@@@H.data> > @INIT   .rsrc @H.reloc@B UuF@ffnf%njX^̀% jhq= ujptYjXVt$ ~fnft>f=arf=zwȃ fXf=arf=zwPf;uL/t ~uu5 mfXf;A u"XPjimsYYV3 3jX^ NTFSFATFAT32USVW3zf33}f]9 ]𫫉]]]fuxSSj5mx};fE:fXf]fEtf;uE8]uIEPhrYEYSSjPtڋEf;tf;Ftf;Ft f;Ft뾋}8]G HHt]Ht5Ht jgEOru=EuEEh~H=EuEE hj#=EuEEhvjhqYYjhVWTVHEPEPSSEj jEjhxSPEPEhPE]E@]];}jjxhPSSEhPSSSu;} jd0q}YEȋESSSSEh PSSSu8]jkpYEPWu_;ÉEt6jlp=YEuEEE E@ hjmp=YEuEEMQMQPE@ ]ۃW諃M߉EQSMSQWPuuuWu讃35Ex uEPWu蠃;ÉEuWSSSEjPuSuq; 8]u.Ex t!fXPEPEPEPuu4 E]]EHIQMQPE x tMA$=uMQMQPjoqoYEWSSjjPuSu˂;|=Ex u4=EuEWShjEjPuSu节Ex u9]tuuWu_9]tu49]tu'uu;}jejfnY_^[UjhhdPd%QQ(SVWejRuV_JFp3W|mpV"u jWnYoWj[S|mp[ujS|mpV"u jn1}WEPEPEPEP|mpTE;}jP eYYMԉMċE؉E}r>f9u7u3P؉]ċEHEԍpȃEf$C@DPڀ؉]ċEL3ʃEPuԍMQPSẼM%E3=ËeEM]ă}|S ju!dYY;]tS>uu9ujXMd _^[**U@SVuW3jLV]]]]H|mjpFp tO|m5pYDP |m=EqPס|mYYSpE@p uj]|mpYDPm |mEqPס|mYYSjp}uj|mp~t8mEu j}kuEPEjEȍEjPEEPEhP]E@]Љ];|'uh uh u~ESSj5m~;uu]9 uH8]tCuj%kYEYSSjP\ tދEf;tf;Ftf;FtKMf;AtB뽈]j\uYfEYu@hPup);} j PaYY9]tu}9]tu}9]tu}jX_^[\ \ U(ESVu 3WF8uYNGj EjPEEPu u E9]}.uhFV hJju|`YYW|_^[SUVW|$jSWEu.?tj|mjpGVXSuj iYjXjj]UVztqUVSTtuV\FGYj\xWYYu"ff=Arf=Zv f=arf=zw f:uj,jSWtjUSyujUSWu jjhYUSV|} WjPp_ _^][U(SVuWjTVDu$|m3WpFpuj hYjX|mj[SSp yuj|mSpFp<u jgYy|mpEPWWEh!@jEjhEWPEPEhPE}E@}};| uN qjPl^ _^[U,SVujUV Cu#|mjpFp~uj gYjX|mj[SSp xuj|mSpFp:u jf|mpEPEh!@E܍EeeejPEPEhPEE@}jP)j ESPE]Puu} jVW]YY^[ TRUEFALSETRUEFALSETRUEFALSETRUEFALSE allowallpathstrueallowwildcardstrueallowremovablemediatruenocopyprompttrueSVt$ WhV@tjXj[;hu=muPj~d=nYYuPjd=nYYuPhd=nYYuPhcdYYh )<t hF=hpYYu%FhpYYnFh&pYYu"FhFpYYmvFhRpYYu"FhzpYYn?FhpYYu"FhpYYnjJcY_^[/?UQeSVuWj[9vFh|pYY@thV>|>(|mjpFp:uj|mjj_Wpsuj|mWpFpu jbEP|mp}jPYYYF}pffUf=+uf=-u2;thHAt+uMEt0(t t tffu jaA|mWpN}j$}t& $P|mp} hPXYYjX_^[RtHxa+At gHyMt \TZwDeviceIoControlFile() status : %X U,SVuEPEh @E܍EjPE3PEhPE]E@]];|@38] SSEEjPEh@ PSSSuVhsYYu^[UPVWuEPEh @ EE5eeejPEؿPEWPEE@օ}!= uSh @EjPEPEWPօ|9j 3Y}E j%7j( EЍEPEPuu_^UPVWuEPEh @ EE5eeejPEؿPEWPEE@օ}!= uHh @EjPEPEWPօ|.jEj(PEPu|E MЉu_^W3nlt7V  fpu]@EV{c|mSpVp|mSjpa|mpdE|mjpV0|mpc5EPEP֍ESEЍE=jPEPEhPE]E@]؉];j|j(PEPuuE9]HEtjr9]uEj\uY;YE|mp.u|mp(c|mp cE|mSput9|mSSpt`tU|mpbE|mjpuu j'OYE|mpb8nEuPujuEP֍ESEЍEjPEEPEhP]E@]؉];Oj|j(PEPuuE9]}j1uELEj\uYEYua9]tuu|mpx|mYYpaEPEP֍ESEЍEjPEEPEhP]E@]؉];u EuE9 uf8nu^SSj05mJa;tIj\uY;YtEPj/MYEYSSjPtUfEf;tLf;FtFV`uSuua;| E j1P_DYY9]tuj20MYjq&MY9]tE8uuX`9]tuK`9]tu>`9]tu1`9]tu$`jX_^[j\DosDevices\%c:UHVEuVh,Pp EPEPEeeeEEPEhPEE@t|uEP_l^\VWj@nY3jYmh-_nr3FAP;t fx.uf@"MB@@;r}t fx*uf@<hWcREuEPjjWEVPSSSude=Et";|!Ftkff= t f= r f= wFFujP3jEEEP8DPPFPEP!Et0suu_^[UQSVueE W3f ftGEf t f r f w}t,f"u 38MMt]f GEBBf futf$xlj_^[D$VW8 wtSvOVOۋu[WO_^RELOADSUVt$W39>Fh.=pYYujhF@ffArfZv farfzwfx:uf9xuQ70)}tuFpYYtG8-rj;YjX_^][I;)r;)w V)jVht$ 3tj^^/? Vt$Wj_jVVYue>u'Fh >Np YYV9jVA;Y)~u6h(>8-r_^SETVW3)h>7YYtF8-|3 v8D$ *_^SETSVW23)h>7YYtF8-|v39*_^[ËT$2t!*;Qu aH-rU(eSnVuW3hV}}}}}*F0;Fff-t$f/t9}uEp9})PbME\HDtEIIt%t t7IItf9x*fx:9}Ef9xE6e9}9}t }uLtjr|mjputz|mpL}E9}u|mp|mpLE|mWpuLt)|mWWpIt@|mjpu#uj|mp+L=nEuP/uj3}ثE]E؊EEtEPh,Buu!L}}uhVQ/YY%}u}u}tuuh 8 }t}uthh7YY39}tu!K9}tuK9}tuKjX_^[j7Y UlES3V+W HHtMHt6HtHu h*u9uhH7YF /j.u h*7YY}8_  SShE5mJ;tdu h6YEYSSj[SP tvEEPh"Bu th&BtGj G jjX_^[HtHtuh4Y2USVu 3W}f;*tO?fQPu f>.f9}]f9tGGFFf;uFFff;txf=?uf9u }ul]GGf=*tff;t2_fQPsuuFPS?t,GGCCffu3f>.u}uFFff;tf=*tjX 33f9_^[] f9J}uމ]>D$A|Z L$A|Z 3;‹\??\%c:\$win_nt$.~ls\i386\\$win_nt$.~ls\nec98\\??\%c:\i386\\nec98\\??\U |mSVWupp1=p3ۍCAPh8FP׃ P4t-=HFupFuPPsCr3;uT3FAPhFP׃ Pu'=FuFuPP;uvFr9 tuXujE1YYhFPYYSShP uSP;u SSP;uujG1Y3Y_^[\DosDevices\%c:\\DosDevices\ \DosDevices\%c:\U\SVuWjHV F3ۉ]0;t{Fff-f/fArfZvfafzfx:f9X8]farfzw  E6:u:uj)8]u K EE#PE:u jE0Y5-N;ÉEjdvCE#Ph4HWEp EWPEjEEjPEEPEhP]E@]]WC;|mjppEVPu|u;~EЋN MtYF VfFB|mpEP/|mpBVEPff)P-/ ujBVdB%PWj* / hPBpjEf-E_fttf f-fpEetf f-frf hXHVYYVYFfMff:f9 uhxNHBmm$uEjPu!B9 uSB;9]t0}t8mt9]tj#'h j'htHj"8mtj,j!-Yjd,AuhxHVp EVPEjEEjPEEPEhP]E@]]V@;*|mjppEVPu|u;|mSxWSvv6^@SvRPS@ShRPR@RPyW@SWSEvv v%@SvRP@ShRP@RP@WT@SWSEvSv?RP!W5@SWvE6 W @SWv EvW @PEuuuuj+i,uj_6?Ou j Vg#YYu?u?jX_^[@PtHHt t HHuE~2zU(|mVup3Y9u Ytu |mpe?9utu|mpP?|mpEPj@MXEEPEjPEPEhPu܉Muu;|u|mp>3^ D$V8u^@0du =mtKm|mp Tu5m+Ym%Vj&*YYhtN|X3^fatfat32ntfs\??\%c:/fs:fat /fs:fat32 /fs:ntfs /fs:ntfs SUVt$ WjwVFd$$-8(wff=-tcf=/t]f=Arf=Zvf=af=zf~:f~|$$f=arf=zw +FFt(QtftqD$$ D$$~fFf=st f=Stf~:ueD$%u^j VYYtf hNVYYu L$$2hNVYYu L$$ hNVYYu L$$@2ۋ?|$$t|$$#WujD$$#ƾPhOVp VIu h5-3;D$9 j[uiQQj5m;tTf%Vjzf=f:B(YD$YjjSPwtfD$f;Ef;EUV;f%Vf=f:;SW|$;u j'Y^ShVWU;h;=VUYYUtED$(Yf f-ftf tf-fQf t?thO9 th*OVYYj@thBOVYYj[\$$ j[hVOVYYVF3Yf89= uhxN:%mmyUD$ jPt$:9= uW:;} jxVYY,t$^ è/SF$hP: f0Vm:U9t$9jX_^][US] VWjhPS9j\PYYtCf s E0:u;~v(;~ r#{u6PYYu~^jX_^[ /delete/addU,eSVuWj{VEs>:F=hSHQMXYYu_f{:uSd9jSx9Eu jP%Y= teuSu>9}hSuYY3>}r)FpEVPEPEj PPuE]ԉEEPhVS}؉}89}t5WWujWu8u0OWWuWWu8Z3SVhi$ 90|mjMp pQMQpE8| jX_^[̋D$V3tR@tKtEHff/tf-ufIf?tfhtfHtuj^tt$ #Y2^jV#YjX\??\%c:\*\??\%c:\\system32\config\??\%c:\\system32\driversUS] VWXPh VPp= PEP׍Eh!@EEjPE3PE hPEuE@uu;EhVP׍EVPjj\hhPEPVVVu d;ƉE@3XPh"VPp 5LPPP֋=x h6VPYYjP6XPhZVPp PPPփ hnVPYYjP5tkjT4t^j3YmpkpkFfXfF ^PPPFPhmmF 05m39uu jX_^[ \registry\machine\xSYSTEMsystem32\configsam\registry\machine\securityadministratorSAM\Domains\Account\Users\Names\\Device\Floppy0StartKey.Key\Device\Floppy0\StartKey.KeyUSVW3V]]]]ĉ]]]]]]]2VE2hE2E|mjppEpP2|mp2E):ÈEhXu5YYEuP֍E=@EЍEPEh?PE]E@]؉];ÉEuuEYYPu<2hXu/2hYu"2h YuYYuuSS2;|\uEEP֍EEEЍEPEh?P]E@]؉];ÉE55 5n:ÈEuj]5 EP֍EEEЍEPEh?P]E@]؉];ÉEhBYuYYu Edh^YPYdYuPxYdYPEP֍EEEЋEE̍EPEhPE@]؉];ÉE>|mf]f]HMMQppEjPuD;ÉE|m@@EEPEPtPuuuuuuT;ÉEk=uFhY3j@dYSjdhPǾdPEP֍EEE}hY/SShE5m/SSSjhYEuEPG0&EhYPSSEj jEjhESPEPEhPE]E@]؉];ÉESSdhPEPSSSuHuE9]dEEEfEfEEE9]}r}ubd8]E t 8]uf9t 8]u f9u]=.{hIYh9Y03=."M D55b +5? 5 5> 5  = mmt8t;uCVph_ Vh_h_Gh_PY3Yj@Yj6GY3j@YPjhPkVPPm}@j7EY}rj8YjPYh`|) u3E}t nj7Pm5xj@f@ Yf(n3󫍅h`P֡mYYPPYYh"`P֡mYYf@ f=arf=zw A4@n@ntPe(P(%.蛶jX_^[SecurityLevel\registry\machine\xSOFTWARE\Microsoft\Windows NT\CurrentVersion\Setup\RecoveryConsoleUDSW5353E]]WV5EhdP֍EEE܍EPEh?P]E@]]@;|FEhdP֍EPhPEjPuD;|u3E9]t u5^E_[SetCommand\registry\machine\xSOFTWARE\Microsoft\Windows NT\CurrentVersion\Setup\RecoveryConsoleUDSW5353]]]V5EhfP֍EEE܍EPEh?P]E@]]@;|FEhxfP֍EPhPEjPuD;|u3E9]t u5^E_[\registry\machine\xSYSTEM\ControlSet%03d\Control\TimeZoneInformationBiasDaylightBiasStandardBiasUdSVMW53ۉ]]5]܉]]EEPjE3Yu󫍅h(hPp5 PEP֍EhhEȍEPE]E@]Љ]֍EPEhP@;EDPhPEjPuӅjk|mp虾|mhppx|mYYjp˱UE;t=urj j 3; t="Pjw:;"t=4t=5u5EEEPj4jL=CtC=t8=t-=t=!tEEEPu ]jh jjj-*Y]Vt$hoF4qJF ^m3U}VWtu jjhPVu jhPVKv E0fXfuj?ZэWPF f4x/Ƀ QRj3tjX_^ U(VWuEPE3EEPEhPEuE@uut;|@xk3EVPUufE,u0;| E ME 0_^ arc\DosDevices\%c:UVujQVehr>uFhrpYYujjhq3FAPhrPp PtPu%EPPuPj4 FrjX^IPL1U, SVuWj3_]jWV]]]]}]t0>uFpPYY 3󫍅Phwj^95uPtEVPSP;}hPSSEhPSSSu;} j`Y[j_9=] u3;s}9=u3EMQ9=Et|K#]}\EH#j^95uPuujux}j`95tfUu+95u3fUujChsP( tj[Y95tZVtjXWu]>EPFpFpt.j=YEYPuuj9NjMj<|YEPFpFpj=@YEYPubF=h{pYYu3VFh>{pYYujFhj{pYYuj^Fh{p׋YY;uuujCt!uj9\VuGtVj:GjDzYu0 jWYjX_^UVuj?VtjXW3}>EPFpXFpt^j=YEYPut:}t#uj9ju}tjj:|Fpj@YYu0 j3ҋˁ([3Ҋ([™3+ƒ3+u>F;r[_^]SVWUt$3ɋ\$ ~3%333333%333333333 3%33Džۋl$E3ۋU33%ϊ؊8[38]38\38^3l$%8a38b38_38`3E3ۋU 33%ϊ؊8[38]38\38^3l$%8a38b38_38`3E3ۋU33%ϊ؊8[38]38\38^3l$%8a38b38_38`3E3ۋU33%ϊ؊8[38]38\38^3l$%8a38b38_38`3E 3ۋU$33%ϊ؊8[38]38\38^3l$%8a38b38_38`3E(3ۋU,33%ϊ؊8[38]38\38^3l$%8a38b38_38`3E03ۋU433%ϊ؊8[38]38\38^3l$%8a38b38_38`3E83ۋU<33%ϊ؊8[38]38\38^3l$%8a38b38_38`3E@3ۋUD33%ϊ؊8[38]38\38^3l$%8a38b38_38`3EH3ۋUL33%ϊ؊8[38]38\38^3l$%8a38b38_38`3EP3ۋUT33%ϊ؊8[38]38\38^3l$%8a38b38_38`3EX3ۋU\33%ϊ؊8[38]38\38^3l$%8a38b38_38`3E`3ۋUd33%ϊ؊8[38]38\38^3l$%8a38b38_38`3Eh3ۋUl33%ϊ؊8[38]38\38^3l$%8a38b38_38`3Ep3ۋUt33%ϊ؊8[38]38\38^3l$%8a38b38_38`3Ex3ۋU|33%ϊ؊8[38]38\38^3l$%8a38b38_38`3T$΋3窪333%33 3333333333 333r]_^[Ex3ۋU|33%ϊ؊8[38]38\38^3l$%8a38b38_38`3Ep3ۋUt33%ϊ؊8[38]38\38^3l$%8a38b38_38`3Eh3ۋUl33%ϊ؊8[38]38\38^3l$%8a38b38_38`3E`3ۋUd33%ϊ؊8[38]38\38^3l$%8a38b38_38`3EX3ۋU\33%ϊ؊8[38]38\38^3l$%8a38b38_38`3EP3ۋUT33%ϊ؊8[38]38\38^3l$%8a38b38_38`3EH3ۋUL33%ϊ؊8[38]38\38^3l$%8a38b38_38`3E@3ۋUD33%ϊ؊8[38]38\38^3l$%8a38b38_38`3E83ۋU<33%ϊ؊8[38]38\38^3l$%8a38b38_38`3E03ۋU433%ϊ؊8[38]38\38^3l$%8a38b38_38`3E(3ۋU,33%ϊ؊8[38]38\38^3l$%8a38b38_38`3E 3ۋU$33%ϊ؊8[38]38\38^3l$%8a38b38_38`3E3ۋU33%ϊ؊8[38]38\38^3l$%8a38b38_38`3E3ۋU33%ϊ؊8[38]38\38^3l$%8a38b38_38`3E3ۋU 33%ϊ؊8[38]38\38^3l$%8a38b38_38`3E3ۋU33%ϊ؊8[38]38\38^3l$%8a38b38_38`3T$΋3窪333%33 3333333333 333r]_^[̋D$@@#Eg@ @ܺ@vT2T$ SUl$ V4 ?;WD$ sBrrvZ (@L$$rN\$ @+ȋ|̓@+ȋD$$ٍJQRhT$D$D$\$ tK@rkB̓D$$T$L$ D$$T$PR@@D$ HD$ u@r zSW@@NuT$D$t͍|ȃ_^][ Vt$WN~XN\8?8rx+QhVjWVVF NVF\N`Vd_^D$SL$ VWPUpx )3#3݋(xj3#Ëi3V 3#Nji3p $3#Ƌi 3ν3#‹i3|3#Ëi3*ƇG 3#Nji3F03#Ƌi3F3#‹i 3ؘi3#Ëi$3D 3#Nji(3[3#Ƌi,3\3#‹i03"k3#Ëi43q 3#Nji83Cy3#Ƌi<3!I֋i3#3b%؋i3#3@@i, 3#3QZ^&)3#3ǶЋi3#3]/؋i(3#3SD i<3#3i3#3Ћi$3#3!؋i83#37i 3#3 i 3#3ZE֋Ƌi43#3؋i3#3i 3#3og3Ƌ#3A0L*3Ƌi3B93‹i 3q i,ǁ"am333Ƌi8Ջ3 8i֋D꾤33‹i3K iǁ`K33i(Ջ3Ɓp3i4֋~(33‹)3' i ǁƅ033iՋ3Ɓ3֋3A$93‹i03 i<ǁ|33i33ÁeVǃ֋) 3D")ƃڋi 3*C ƒi8 3#Ãi 3Ձ9ǃ֋i0 3Y[eƃڋi 3  ƒi( 3}Ãi 3]ǃ֋i 3O~oƃڋi< 3, ƒi 3CÃi4 3Nǃ֋i 3~Sƃڋi, 35: ƒi 3*Ãi$ 3ӆD$֋ًHщHP]H px _^[L$D$PQxUES3V ]}W]E}} ~9] u9]$l9](c5h,h h(h ֿ SWh W;.3}諫3}j3Ydj,Yj}Yj}Yj}Y󫍅Pu ؁4udPEPuu!EEdPSu,؅EHHtVHuEEtEpt>ff=w.f}u'ȋ}EEȃ ~wuuif}t {tPPtvPtPB}EEEPju!؅EPuu؅}jEYdjPd,PEPOuR}tLEjPPI؅ }EEPEP,PEPtoEPEPEPuu@؅|RM$3f9Et.u EPu\؅|+h u jM(@} E( j3Ydj,Yj}Yj}Yj}YjY}t!MʃuT3}諫}t#M3ʃu*3}𫫋 _^[$U4MSVWE3h0P]]EEEԋEEЍEPEhPE@]܉]@;ÉE|qE5DPEuf]f]]SjPu=#Eu0uj;ÉEtMQuPEjPu։EE9]|E} jp Y9]tu7}t uEE_^[UpSVEWPuEu Pu~w=]AfffCu cPjk Cu Ht EP EjPEP+EjPEPFtj EhPEP=EPjP  {ȃsPPQ 3 Wu%_^[Uuuu juuD]VW|$tGt$ t?ffv*Pjn Fu#fWVfF jV3 _^UpSVuWA] 6M+jX9#9EPACjPEPj/EhPjEVPj)EVPEPEPjPy CPj P j3Y}j@YfEP&{jEWPGj)EVP;jEWP/j/EhPEPVjY{(u3jYt }j!3}EsjxY3jX_^[U0E V5WE3hXP}֍EEE؋EEԍEPEh?PE@}}@;SEhHP֍E5DPEuWjPu֋؁#u,uj>tEPEuWjPu֋|u M G 4utW[_^UeS]E܉EEEEVEWPS^j 3ZhʍuʍʍWVPhuWVPrhuWVPYhhuWVP@5P@P֍PHP֍P8P֍PPPj@YUj@3XMEUUHE}d|8P`x3}]3}fEMPEPUU]Xhl\pUUt֍EPEP(fEEEPEhPfEfEfE @EPh Pjuu܋_}jȍEPEP$3ҊD<0| <90#r EPu@|>}u3>_^ %%D$T$SVpW;ƍZsGA;u;r_^[UVEWPu u}EVPWW|EVPWB_^ t$ t$ t$ SVWU33ҋt$l$|$t+A#3#3ۊÊ2؈GMu]_^[P SV@t$ WUIu33l$3337D AG3D79L$3u3Ɂr]_^[ L$T$ D$RPQ"2VbpT|jXH2"zhD0nXH0~Bv`TB4*xXJ6  lT8$8FXpX *8X *8` X *8X *8SPSSPQHLRHLQNCENCRNCQNAKOFFUNRERRRSPREQRSURQURESAU2AUTCHLNEGr  ?/?TYPESYSTEMROOTSETRMDIRRENAMERENRDMOREMKDIRMDMAPLOGONLISTSVCHELPFORMATFIXMBRFIXBOOTEXPANDEXITERASEENABLEDISKPARTDISABLEDIRDELETEDELCOPYCLSCHKDSKCHDIRCDBATCHATTRIBAUTOFMT.EXEAUTOCHK.EXE\H\registry\machine\xSECURITYsecurity\registry\machine\xSYSTEMsystem\registry\machine\securitysam\registry\machine\xSOFTWAREsoftwarennFAT32NTFS FAT16NEW d)ކJ <g/Y"VFPolicy\PolSecretEncryptionKeySAM\Domains\Account%s%8.8lxSAM\Domains\Account\Users\NTPASSWORD0123456789012345678901234567890123456789!@#$%^&*()qwertyUIOPAzxcvbnmQQQQQQQQQQQQ)(*@&%CurrentSelectControl\Lsa\DataControl\Lsa\GBGControl\Lsa\Skew1ControlSet%s%03d\%sControl\Lsa\JDxph`xph`xph`QV33Ҹ@PXrs3۹Q Yt ^YuKM+wF&W> u@ 3R/[r&6 >CأEC;IGT$] 7PJJ 2>KMX2=uVWUKMRQ$t'P6Ƞ 2<tX*$@rB2;sSR& ZSV_[YZr ˃+u]_^NTLDR UXMSWIN4.1 )NO NAME FAT32 VWȎؾ3|_^P|P3ɎѼ{ٽ|VF@~uI~*wCfFf @L}}2< t2f>6f6f>Ffff  gff>:f:ffff >ff:Zf f>:f:fffof gfX ffh f+$6 +]h Pf`ff ffff߃fPfag@gf8Lgf93f  gx #g:H fgp YfQffYgfxgf@f+f.gfg@ 4gfPg:J@gfrB fQffYgxg@f3g{f`gfSgf fgrfagfSgfJfAf+f`g{ffafSfPfQfWsff_fYf;ff+fff ff fffXff[f`g{ffafSfPfQfWfQf3f ffRf ffZffPf fffXfYf_fYf;fff`߃fPfaf+fff fffXff[ef`&gf_&gfOf ffffIf &g&gfffIfaf`ffffRfZfRfJf0f ffJfffVffJffQff ffFf ff>ff?_fSfGf&VfPf3f ffRf fVf ffZffJff f+f;fff+fZuffPf3f ffQfYf f ffJfff;f f;ff륃fJff f;ff낃ffJf[_f? fafff6Zf6RfRfQfRfZf>Vfff}f+& f>ZfZffff ffXfV'f^f f[f[fYfZf3f`fPfQf3f ffRfWSf_f of ffZfffYf f;f+fXffPfQfXffPffQfW߃fPf_f>NfYfXfpfaf`f&VfVUfaf`f&ff2fff>BfafPfSfQfFffffffgfYf[fXg{f+gfsgfVf; gff;f+g^f+g;>f9ff;!ffPgf ffffffCfXf+f+ff+f+g ff+fSfRfgffIfKf fgfKfIffZf[fSfRf+gff+g ff+fZf[ffgffIfKf fgfKfIffZf[f fQfVg>a g>zg. ff^fYfPfQff.gfXgCgf@ff fYfYf2f fYfYf3f2gfRgfBf@fNff3f6^fPfXf 0fHfPrfZfYf[fSfQfRfBgf@f tfYfYfYfYfYf3fQfPffff[fSf fzf[fYf /fffPfS#f[f_f [ff f@fQf ff(f Rff>ffY&f9.&f?-&$&fG؋%t׌&fGfYf3à3м|ȎR^t|uu=u73=u~Ȏ4ro5=Uu_Zhj h v` ah~j h X53h PVށî1Ɗ*Vށî2Ɗjj j^  DŽk$3 &g&Gi&7&m&Oku3 g&i&G Ȏ3K |.k.k.i.gCDBOOT: Cannot boot from CD - Code: 0 CDBOOT: Couldn't find NTLDR CDBOOT: Memory overflow error 33ҋ6&;!Q3ɊYo;7+ʀ>ӋڃQYŽ뷺A)>Ã.SQYÎ[+tJ+‹n> &Gu &Gu&8G jUSVRPmGGGG GF F FFF>> } } GGGG mB>}". Z XZ^[]UQSP tPSv66 X[Y]P&G&G&G &G XUjjhjj &&&&hjr4hGFFr av]$SETUPLDR.BINBOOTFIX.BINI386UXMSWIN4.1 )NO NAME FAT32 3ɎѼ{ٽ|NV@sf@fр?AfffF~u8~*w2fFf +H}}t >aB$fX[fXfX-f3ffŠff6֊$ ̸ fofaà <t  A disk read error occurred NTLDR is missing NTLDR is compressed Press Ctrl+Alt+Del to restart UNTLDR$I300Ȏf f ffNf@fffNffRf f3ffV fJf"fRf&fRf*fRf:fRfBff"f Wf.ff&f2ff*f6f.f $gxgfPgBgfH fbgfHf^f^f f3ffffBf^fFf>2f>6f6f>Ffff  gff>:f:ffff >ff:Yf f>:f:fffnf gfX ffh f+$6 +h Pf`ff ffff߃fPff?_fSfGf&VfPf3f ffRf fVf ffZffJff f+f;fff+fZuffPf3f ffQfYf lf ffJfff;f f;ff륃fJff f;ff낃ffJf[_f? fafff6Zf6RfRfQfRfZf>Vffff+& f>ZfZffff ffXfV'f^f f[f[fYfZf3f`fPfQf3f ffRfWSf_f =f ffZfffYf f;f+fXffPfQfXffPffQfW߃fPGf_f>NfYfXfpfaf`f&VfVUfaf`f&ff2fff>BfafPfSfQfFffffffgfYf[fXg{f+gfsgfVf; gff;f+g^f+g;>f9ff;!ffPgf ffffffCfXf+f+ff+f+g ff+fSfRfgffIfKf fgfKfIffZf[fSfRf+gff+g ff+fZf[ffgffIfKf fgfKfIffZf[f fQfVg>a g>zg. ff^fYfPfQff.gfXgCgf@ff fYfYf2f fYfYf3f2gfRgfBf@fNff3f6^fPfXf 0fHfPrfZfYf[fSfQfRfBgf@f tfYfYfYfYfYf3fQfPffff[fSf fzf[fYf /fffPfS#f[f_f [ff f@fQf ff(f Rff>ffY&f9.&f?-&$&fG؋%t׌&fGfYf3àxph`xph`xph`xph`xph`xph`00Hx`&l(d T L^3<p}(S{  >r?ZsjO.>&`sv|vp hz`pPpDz<$^2 U Uxph`xph`xph`xph`xph`JanFebMarAprMayJunJulAugSepOctNovDecxph`l`TH<llxph`3м|PP|PW˽8n| uIt8,t<tNFs*F~ t ~ tuҀFFV !s뼁>}Ut ~tȠ멋W˿Vr#$?ފCцֱB9V w#r9Fs|NVsQOtN2VV`UAr6Uu0t+a`jjv vjh|jjBaasOt 2VaInvalid partition tableError loading operating systemMissing operating system,DcU IPL1 t"2۴rusk$0@33P-X3rAr4trPűX.6 .V2۴ru .^ô U U U U NEC ߰ٺ߭ŒfBXNNj[vO ްޮ 2.70 Copyright (C) NEC Corporation 1985,1995 F̈̑IiNjȗIŒfBXNSCSIŒfBXNfBXN@j@@[@I@WtH[}bgtH[}bgFEL[̈̑I@L[ȗI@^[L[NN”\ȗ̈悪܂FEL[ȗI@L[̈̑I^N@@@@@@@@@@@@@@@@^[L[̈̕\G[FfBXNǂݎɎs܂G[FfCXN݂Ɏs܂ǂꂩL[ĂF͎Nɐݒ肳ꂽ̈ł EPL[N̐ݒ EPL[N̉u.u{uqsmtx&%=u9&&%:u+&T&L^3s!U ˃ slGP&>!u&&@tXs!Xt &?tS[t=u= u9 u&T&Ly㠄3rU &?$<uC u> u7 u0+|tt>~u.&At&Ar!&WtP &XuĀtư&t,&}u&r!&WtP & XuKĀtŰ&t&r!&WtPm & XuĀtˠ2Ä&t&r!&WtP/ &N XuĀtˠY2ð3ۊ؀`?t52u*2s-r &WtP & Xu |tt>~u.&AtrQY tĀuմ&t&}urQY tĀuԴ&tarQY txĀu'&t8rQ[Y tOĀuڰS3ۊ؀`?t!2urQY t[ [|t=t3>~u).&AtA@u~tA@u&tA@uXPS3ذ33ۊ؀`?t 2uA|t9t/>~u%S"}A[&t A@u[X&UurP2V3t2 r1 20 2 0:^uw 뤀w uX23ɺ3r%&>VOu&>L1u|;ô-|(PS3FL QPRvPXPP3X>|u@u9>~u0t#Q.}YuQ2Ʉ}t*Y|tptf>~u\.&At:uA@u&t&}u:uA@u&t:txA@u&t:tbA@u갠S3ۊ؀`?[tS2:t-A|u7u0>~u'S3ۊ>}tà:[s /?S3ۊ؀`?[uyS2  P.vPX[Àu2B URPXP|XZtt :uRP!XZsJ:PSRZ[Xtt&#Zu|10PSRZ[Xt"J$ } tP&>VOu &>L1uKʀt tuQYyutY^NJtQ&>VOu &>L1uhʵt:tQu#QY-Nu:uPX:u;uVOu &>L1uu*렀t^t:u zuRPkXZsRP[XZs 1GPSRLZ[X;&>VOuU&>L1uL PRt?333sZXVP  XUPXPR&T&L 㠄3sZXQ ZP  XUPR&t &G R333ZsR3ҴZs&wu2&u^mZXP3&trs 2u N, < t < t< t̀IXPhPPXR&W$tmZv#h(h&-h&SPX`PQ3Ɏ&YPS+Î[XSP t42u)RQ2YYQ22Y2X$PX[þ> EPL[N̉ ͎Nɐݒ肳ꂽ̈łfBXNAC P3Xx1ûU.t IuraIu2eTً2P&XtT䠨 t椸  A lY L/Y3&?vt?7Q_Y7O8<2I,G&# 9//&0~Køc2,(/ 87^7?øf<6<:,$Irø2H7{"u%,o ZiJc"P]vWrQøBJ\D7>F8/2@,5&$ Ð ÑÏNɐݒ肵܂ix^mjHPSQRe~0ȁytYuZY[X&O!n.tN.uZY[XNZY[X롩@tQxph`xph`xph`xph`@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                            @@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @@ @ @ @ @@ @ @@ @B@B@B@@@BB@BBB@B@@@@BBB@BB@BB@@                    0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$  $ $ $$  $ $             $$  $ $ $$  $ $                  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((          """"   " " " " ((((((((    """" ( ( ( ("("("("(:__H     0123456789abcdef $DN@LH2VbpT|jXH2"zhD0nXH0~Bv`TB4*xXJ6  lT8$8FXpZwCreateFiledRtlInitUnicodeStringZwCloseRtlMultiByteToUnicodeNmemmove'ZwFsControlFileZwDeviceIoControlFiler_except_handler3wcsrchr0ZwOpenFilewcscpywcslenVZwSetInformationFilewcschr_wcsicmpwcscmp-DbgPrint@ZwQueryInformationFilesNlsOemLeadByteInfoqNlsMbOemCodePageTagRtlUnicodeToOemNfZwWriteFileKZwQueryVolumeInformationFilewcscat5ZwOpenSymbolicLinkObjectswprintfj_allmulwcsncpy=ZwQueryDirectoryFilek_allremi_alldivKeDetachProcessKeAttachProcessRtlUnicodeStringToIntegerwcsncatLZwReadFileJZwQueryValueKey1ZwOpenKeyRtlTimeToTimeFieldsxExSystemTimeToLocalTimeRtlSecondsSince1970ToTimezNtCloseHZwQuerySymbolicLinkObject|_strnicmpwcsstr!ZwEnumerateKeyDZwQueryKey^ZwSetValueKey_wcsnicmpntoskrnl.exeHalGetEnvironmentVariableHAL.dll"SpMemFree=SpUnmapFile!SpMemAlloc)SpOpenAndMapFileSpEnumerateDiskRegionsGWriteNtfsBootSector SpDetermineOsTypeFromBootSectorCIpSpBootCodeIoCFmtFillFormatBuffer1SpPtGetSectorLayoutInformationNtfsMirrorBootSectorSpDupStringW(SpNtNameFromRegion7SpRetreiveMessageTextSpConcatenatePaths6SpRenameFileCSpvidClearScreenRegionFSpvidScrollUpASpkbdGetKeypressDSpvidDisplayOemStringESpvidDisplayString SpCopyFileUsingNamesSpGetFullPathNameSpExpandFileBSpkbdIsKeyWaitingSpExecuteImage9SpSetAutochkCallback-SpPtDetermineRegionSpaceSpFormatMessage0SpPtGetOrdinal4SpRegionFromDosName3SpPtSectorCountToMB2SpPtPrepareDisks.SpPtDoCreate/SpPtDoDelete5SpRegionFromNtNameSpFileExists,SpPromptForDisk SpLoadUnloadKey@SpdTerminate?SpdInitializeCommandConsoleInterfaceSpArcNameFromRegion8SpRtlFormatMessage<SpStringToUpperSETUPDD.SYSSplangGetCursorCharSPDDLANG.SYS RtlCompareMemoryGExFreePool7ExAllocatePoolRtlCopyUnicodeStringRtlUnicodeStringToAnsiStringaRtlInitAnsiString 8Ph  ܬ`4VS_VERSION_INFO?StringFileInfo040904B0LCompanyNameMicrosoft Corporationt&FileDescriptionWindows NT Setup mini command console8 FileVersion5.00.2179.1: InternalNameSPCMDCON.SYSt(LegalCopyrightCopyright (C) Microsoft Corp. 1981-1999B OriginalFilenameSPCMDCON.SYS~/ProductNameMicrosoft(R) Windows (R) 2000 Operating System< ProductVersion5.00.2179.1DVarFileInfo$Translation 4: <<Microsoft Windows 2000(TM) Recovery Console. The Recovery Console provides system repair and recovery functionality. Type EXIT to quit the Recovery Console and restart the computer. The command is not recognized Type HELP for a list of supported commands. dThe parameter is not valid. Try /? for help. The specified drive is not valid, or there is no disk in the drive. \The path or file specified is not valid. @The file cannot be opened. lAn error occurred during the file read operation. ,Access is denied. More: ENTER=Scroll (Line) SPACE=Scroll (Page) ESC=Stop hAn error occurred during directory enumeration. hm/d/y h:na*ap NOTE TO LOCALIZERS: m=month, d=day, y=year, h=hour (12-hour), H=hour (24-hour), n=minutes, a=am/pm, *=end. Following * are abbreviation chars for AM and PM. DNo matching files were found. `There is no floppy disk or CD in the drive. DThe rename operation failed. @%1, Are you sure? (Y/N) %0 yYnN DThe delete operation failed. PThe directory could not be created. tA directory or file with the name %1 already exists. The file name, directory name, or volume label syntax is incorrect. xThe system cannot find the file or directory specified. PThe directory could not be removed. @The directory is not empty. XThe name specified is not a directory. L The volume in drive %1!c! is %2 X The volume in drive %1!c! has no label h The volume Serial Number is %1!04x!-%2!04x! 0 Directory of %1 H %1!u! file(s) %2 bytes 4 %1 bytes free HThe drive could not be checked.  The volume appears to be in good condition and was not checked. Use /p if you want to check the volume anyway. The volume appears to contain one or more unrecoverable problems. |CHKDSK found and fixed one or more errors on the volume. LCHKDSK is checking the volume... xCHKDSK is performing additional checking or recovery... 4%1!u!%% completed.%0 There is no disk in drive or the file system is not supported. 4Volume %2 created %1 ,Volume created %1 `The volume Serial Number is %1!04x!-%2!04x! %1!9.9s! kilobytes total disk space. %2!9.9s! kilobytes are available. %3!9.9s! bytes in each allocation unit. %4!9.9s! total allocation units on disk. %5!9.9s! allocation units available on disk. \CHKDSK has finished checking the volume. xThe file or directory is being used by another process. (Drive Mapping HOverwrite %1? (Yes/No/All): %0 nNyYaA DThe file could not be copied. D %1!u! file(s) copied. P%1!c!%2!c! %3!s! %4!8u!MB %5!s! L%1!c!: %2!s! Which Windows 2000 installation would you like to log onto (To cancel, press ENTER)? %0 PType the Administrator password: %0 xThe password is not valid. Please retype the password. dAn invalid password has been entered 3 times. The service currently has start_type %1. Please record this value. dThe new start_type for the service has been set to %1. The computer must be restarted for the changes to take effect. Type EXIT if you want to restart the computer now. The registry entry for the %1 service cannot be located. Check that the name of the service is specified correctly. lThe registry entry for the %1 service was found. $Using the ENABLE command, you can enable a Windows system service or driver. ENABLE servicename [start_type] servicename The name of the service or driver to be enabled. start_type Valid start_type values are: SERVICE_BOOT_START SERVICE_SYSTEM_START SERVICE_AUTO_START SERVICE_DEMAND_START ENABLE prints the old start_type of the service before resetting it to the new value. You should make a note of the old value, in case it is necessary to restore the start_type of the service. If you do not specify a new start_type, ENABLE prints the old start_type for you. The start_type values that the DISABLE command displays are: SERVICE_DISABLED SERVICE_BOOT_START SERVICE_SYSTEM_START SERVICE_AUTO_START SERVICE_DEMAND_START Using the DISABLE command, you can disable a Windows system service or driver. DISABLE servicename servicename The name of the service or driver to be disabled. DISABLE prints the old start_type of the service before resetting it to SERVICE_DISABLED . You should make a note of the old start_type, in case you need to enable the service again. The start_type values that the DISABLE command displays are: SERVICE_DISABLED SERVICE_BOOT_START SERVICE_SYSTEM_START SERVICE_AUTO_START SERVICE_DEMAND_START PThe %1 service is already disabled. |The service is missing the Start value key. The system registry may be damaged. If your system is currently not starting correctly, you can try restarting it with the Last Known Good configuration or you can try repairing the Windows 2000 installation using the setup program's repair and recovery options. The system registry does not appear to have an active ControlSet key. The system registry may be damaged. If your system is currently not starting correctly, you can try restarting it with the Last Known Good configuration or you can try repairing the installation of Windows 2000 using the setup program's repair and recovery options. LThe service is already set to %1. The start_type specified is not valid. Valid start types are: SERVICE_BOOT_START SERVICE_SYSTEM_START SERVICE_AUTO_START SERVICE_DEMAND_START 8%1 could not be located in either the startup directory or the CDROM drive. Type the full path (including drive letter) for the location of %1: %0 %1 could not be located in the startup directory. Checking drives for installation source or CD... d%1 cannot be found in the specified location. Checks a disk and displays a status report CHKDSK [drive:] [/P] [/R] [drive:] Specifies the drive to check /P Check even if the drive is not flagged dirty /R Locates bad sectors and recovers readable information (implies /P) CHKDSK may be used without any parameters, in which case the current drive is checked with no switches. You can specify the listed switches. CHKDSK requires the AUTOCHK.EXE file. CHKDSK automatically locates AUTOCHK.EXE in the startup (boot) directory. If it cannot be found in the startup directory, CHKDSK will attempt to locate the Windows installation CD. If the installation CD cannot be found, CHKDSK prompts for the location of AUTOCHK.EXE. LCopies a single file to another location. COPY source [destination] source Specifies the file to be copied destination Specifies the directory and/or file name for the new file The source may be removable media, any directory within the system directories of the current Windows installation, the root of any drive, the local installation sources, or the Cmdcons directory. The destination may be any directory within the system directories of the current Windows installation, the root of any drive, the local installation sources, or the cmdcons directory. The destination cannot be removable media. If a destination is not specified, it defaults to the current directory. COPY does not support replaceable parameters (wildcards). COPY prompts if the destination file already exists. A compressed file from the Windows installation CD is automatically decompressed as it is copied. Displays the name of the current directory, or switches to a new directory. CHDIR [path] CHDIR [..] CHDIR [drive:] CD [path] CD [..] CD [drive:] CD .. Specifies that you want to change to the parent directory. Type CD drive: to display the current directory in the specified drive. Type CD without parameters to display the current drive and directory. The CHDIR command treat spaces as delimiters. Use quotation marks around a directory name containing spaces. For example: cd "\winnt\profiles\username\programs\start menu" CHDIR only operates within the system directories of the current Windows installation, removable media, the root directory of any hard disk partition, or the local installation sources. @Clears the screen. CLS Deletes one file. DEL [drive:][path]filename DELETE [drive:][path]filename [drive:][path]filename Specifies the file to delete. DELETE only operates within the system directories of the current Windows installation, removable media, the root directory of any hard disk partition, or the local installation sources. ,The start_type of the service was not changed. To change the start_type, specify a start_type. Valid start types are: SERVICE_BOOT_START SERVICE_SYSTEM_START SERVICE_AUTO_START SERVICE_DEMAND_START d Displays a list of files and subdirectories in a directory. DIR [drive:][path][filename] [drive:][path][filename] Specifies drive, directory, and/or files to list. DIR lists all files, including hidden and system files. Files may have the following attributes: D Directory R Read-only H Hidden file A Files ready for archiving S System file C Compressed E Encrypted P Reparse Point DIR only operates within the system directories of the current Windows installation, removable media, the root directory of any hard disk partition, or the local installation sources. x Logs on to a Windows 2000 installation. LOGON LOGON lists the detected installations of Windows 2000, and requests the local administrator password for those installations. \To restart your computer, press ENTER. Displays the drive letter mappings. MAP [arc] MAP lists the drive letter to physical device mappings that are currently active. The arc parameter tells MAP to use ARC paths instead of Windows 2000 device paths. Displays a text file to the screen. MORE filename or TYPE filename MORE or TYPE displays a text file. Renames a single file. RENAME [drive:][path]filename1 filename2. REN [drive:][path]filename1 filename2. You cannot specify a new drive or path for your destination file. RENAME will only operate within the system directories of the current Windows installation, removable media, the root directory of any hard disk partition, or the local installation sources. Creates a directory. MKDIR [drive:]path MD [drive:]path MKDIR only operates within the system directories of the current Windows installation, removable media, the root directory of any hard disk partition, or the local installation sources. Removes (deletes) a directory. RMDIR [drive:]path RD [drive:]path RMDIR only operates within the system directories of the current Windows installation, removable media, the root directory of any hard disk partition, or the local installation sources.  For more information on a specific command, type command-name /? or HELP command-name. Repairs the master boot record of the boot partition. FIXMBR [device-name] device-name Optional name that specifies the device that needs a new MBR. If this is left blank then the boot device is used If FIXMBR detects an invalid or non-standard partition table signature, it prompts you before rewriting the master boot record (MBR). FIXMBR is only supported on x86-based computers. lThis is only supported on x86-based computers. tWriting new master boot record on physical drive %1. PAn Interrupt 13 hook was detected. xFIXMBR could not detect a master boot record signature.  ** CAUTION ** This computer appears to have a non-standard or invalid master boot record. FIXMBR may damage your partition tables if you proceed. This could cause all the partitions on the current hard disk to become inaccessible. If you are not having problems accessing your drive, do not continue.  The new master boot record has been successfully written.  The new master boot record could not be written. The disk may be damaged.  Canceled writing the new master boot record write operation. h The old master boot record cannot be read. 4 This is a NEC PC98. dAre you sure you want to write a new MBR? %0 Writes a new bootsector onto the system partition. FIXBOOT [drive:] [drive:] Specifies the drive to which a boot sector will be written, overriding the default choice of the system boot partition. FIXBOOT is only supported on x86-based computers. p The old boot sector information cannot be read. T The boot sector cannot be fixed. l The new bootsector was succcessfully written. The file system on the startup partition is unknown. FIXBOOT is attempting to detect the file system type. hThe file system on the startup partition is %1. L The target partition is %1!c!:. X FIXBOOT cannot open the partition.  The bootsector is corrupt. FIXBOOT is checking the filesystem type... dThe partition is using the NTFS file system. `The partition is using the FAT file system. h FIXBOOT is checking for an operating system. X FIXBOOT is writing a new boot sector.  FIXBOOT cannot find the system drive, or the drive specified is not valid. `The system cannot find the file specified. tCOPY does not support wildcards or directory copies. |Sets the current directory to systemroot. SYSTEMROOT You can use the REPAIR command to repair your system. REPAIR PathtoERFiles PathtoNTSourceFiles /NoConfirm /RepairStartup /Registry PathtoERFiles: Path to the Emergency Repair Disk Files (Setup.log, autoexec.nt, config.nt). If this parameter is not specified, REPAIR prompts the user with 2 choices: Use a floppy disk, or use the repair info stored in %windir%\repair. PathtoNTSourceFiles: Path to the Windows Installation CD files. This is the CD-ROM drive if not specified. NoConfirm: Replace all files listed in setup.log without prompting the user. By default, the user is prompted to confirm the replacement of each file. Registry: Replace all the registry files in %windir%\system32\config with the original copy of the registry saved after setup and located in %windir%\repair. RepairStartup: Repair the startup environment, boot files, and boot sector. 4Not yet implemented. Executes commands specified in a text file BATCH Inputfile [Outputfile] InputFile Specifies the text file that contains the list of commands to be executed. OutputFile If specified, contains the output of the specified commands. If not specified, the output is displayed on the screen. Formats a disk for use with Windows 2000. FORMAT [drive:] [/Q] [/FS:file-system] [drive:] Specifies the drive to format. /Q Performs a quick format. /FS:file-system Specifies the file system to use (FAT, FAT32, or NTFS) HThe drive cannot be formatted. PFORMAT is formatting the volume... CAUTION: All data on non-removable disk drive %1 will be lost! Proceed with Format (Y/N)?%0 ,Use the DISKPART command to manage the partitions on your hard disk volumes. DISKPART [/add|/delete] [device-name|drive-name|partition-name] [size] /ADD Create a new partition /DELETE Delete an existing partition device-name Device name for creating a new partition. The name can be obtained from the output of the MAP command. An example of a good device name is \Device\HardDisk0. drive-name This is a drive letter-based name for deleting an existing partition. An example of a good drive name is D:. partition-name This is a partition-based name for deleting an exisiting partition and can be used in place of the drive-name argument. An example of a good partition name is \Device\HardDisk0\Partition1. Note: If you use the DISKPART command with no arguments, a user interface for managing your partitions appears. xSpecify the location of the emergency repair files? %0 PDELETE does not support wildcards. 0AllowWildCards = %1 0AllowAllPaths = %1 <AllowRemovableMedia = %1 ,NoCopyPrompt = %1 PYou cannot format removable media. hCHKDSK found one or more errors on the volume. HPlease enter your user name: %0 \Use NET USE to Map a network share point to a drive letter. NET USE [\\server-name\share-name /USER:domain-name\user-name [password] | drive-letter: /d] server-name The server that you wish to connect to. share-name The share that you wish to connect to. domain-name The domain to use when validating the credentials for user-name. user-name The user within domain-name to use for connecting to \\server-name\share-name. password You may, optionally, enter the password on the command line. Note: NET USE will prompt for the password if it is not on the command line and will automatically assign a drive letter to the connection if it successfully connects. drive-letter The drive letter that NET USE as assigned to a server connection. /d Indicates that this connection is to be disconnected. HPlease enter your password: %0 (NET USE failed. X%1 has been mapped to drive letter %2. There are open files and/or incomplete directory searches pending on the connection.  Invalid selection. Please select a valid installation number. Changes attributes on one file or directory. ATTRIB -R|+R|-S|+S|-H|+H|-C|+C filename + Sets an attribute. - Clears an attribute. R Read-only file attribute. S System file attribute. H Hidden file attribute. C Compressed file attribute. To view attributes, use the DIR command. Use the EXIT command to quit the Recovery Console and restart the computer. The LISTSVC command lists all available services and drivers on the computer. DType the startup password: %0 ,Startup Key Disk Expands a compressed file. EXPAND source [/F:filespec] [destination] [/Y] EXPAND source [/F:filespec] /D source Specifies the file to be expanded. May not include wildcards. destination Specifies the directory for the new file. Default is the current directory. /Y Do not prompt before overwriting an existing file. /F:filespec If the source contains more than one file, this parameter is required to identify the specific file(s) to be expanded. May include wildcards. /D Do not expand; only display a directory of the files which are contained in the source. The destination may be any directory within the system directories of the current Windows installation, the root of any drive, the local installation sources, or the cmdcons directory. The destination cannot be removable media. The destination file cannot be read-only. Use the ATTRIB command to remove the read-only attribute. EXPAND prompts if the destination file already exists unless /Y is used. HThe file could not be expanded. H %1!u! file(s) expanded. 8 %1!u! file(s). DNo files matching '%1' in %2. POverwrite %1? (Yes/No/All/Quit): %0 nNyYaAqQ PThe source file contains multiple files. The -F:filespec option is required to specify which file(s) are to be expanded. -F:* may be used to expand all files. ^C %1 <Unable to create file %1. \Displays and sets Recovery Console environment variables SET variable = parameter SET AllowWildCards = TRUE To display a list of Recovery Console environment variables, type SET without parameters. The Recovery Console supports the following environment variables: AllowWildCards Enable wildcard support for some commands (such as the DEL command). AllowAllPaths Allow access to all files and folders on the computer. AllowRemovableMedia Allow files to be copied to removable media, such as a floppy disk. NoCopyPrompt Do not prompt when overwriting an existing file. The SET command is an optional Recovery Console command that can only be enabled by using the the Security Configuration and Analysis snap-in. |The SET command is currently disabled. The SET command is an optional Recovery Console command that can only be enabled by using the the Security Configuration and Analysis snap-in. Are you sure you want to write a new bootsector to the partition %1 ? %0 xCannot create a new partition of size %1 MB on disk %2. Cannot change the compression attribute for the specified file or directory. \Batch file cannot contain BATCH command. 223u333333440464<4B444445}555555/6Y666y77777777778M8}88890999:|::: ;;M;q;;;e<C>H>U>k>>>>r?????800)0;0K000011112K2X22222 3H3h3s3444445 55#5*5;5C5J5\5555555566.686M6e666667<78)889<9D9T9q99::+:?:::::::;$;.;<;G;N;V;];k;u;|;;;;<1<>>>>?>E>K>Q>a>o>w>}>>>>>>>>>???"?(?C?I?d?p????????? H"0:0N0]0d0q0000000001111=1C1L1d1m111111112 22"232?2D2K2X2`2h22222222233]333333444"4.4;4A4N4[4i4{444 555505M5X5^5n5555556696?6F6R6Z66666#7C7N77889979G9_9m9999::$:1:A:V:i:y:::;(;Q;p;y;~;;;;;<=%=6=i=v=========> >8>t>>>>>:?P?e?l?v????0020A000000 1L1m1111.252|22222223 3333333/4<4t444_5555555 6 6H6r6 770778/888>8W8h88889)9?9F9g9z9999:::;;S=X======L>_>}>>>>>>>> ???'?7?O?i??@x000000011^123E44467747;7r7777799999::):\:m:;";+;H;O;Z;`;~;;;;;;;7>L>Y>^>>>>>>>>>?Pb0t000001#1<1K1]1h1o111122b2p22222222233(4-4t44444c5666 77B7m7t777777 8<8B8G8r8w8}888l::::::;;*;7;@;;;;<<,<3!>>>'?`P0W0]0b0g0m0x00000000000 1(181]1m1122"2)2.2J2U2^222222222233%3*3T3[333 44%444<4X4`44445555 6676a6g6I7\7}777778899[9b9h9999:o:::; <<7>>>??#?G?N???????p 00)0=0i00000011132e22222<3N3Y3j33394X4455%6166666627778F888888888Q9s9999::::*:0:<<<<A?L?b?h???(.0;0z0001O1x1111252}22233333.4_4l4y444444@5G55556F6p66677777>8C8L8Q8W8888889949s9999999::(:1:_:: ;A;V;;;;;;;; <*>>>f>-0C77777"8)878H888999999999::":;:C:K:S:y:::::::::: ;;1;9;A;I;o;y;;;;;;;;;<<'>#>+>Q>[>h>u>>>>>>>>> ???!?G?Q?^?k??????????0000=0G0T0a0z00000000001 11111111122+282Q2Y2a2i222222222 33!3.3G3O3W3_3333333334 44$4=4E4M4U4{4444444445 5535;5C5K5q5{55555555566)61696A6g6q6~66666666677'7/777]7g7t777777777788%8-8S8]8j8w888888888 999#9,;l>2C2H2O2T2[2d245555667=7I7|777899R9`99:);o;z;; <<<=A=R=^==">>>O>k>>>>???0B00%1a12G22?3i33[44499::::;;; ;4<8< ?$?(?,?0?4?8?>> >>>>> >$>(>,>0>4>8><>@>D>H>L>P>T>X>\>`>d>h>l>p>t>x>|>>>>>>>>>>>>>>>>>>>>>(?,?0?4?8?/?n.. k++o//j**m--[{]}\|\| 22@66^-_`0a1b2c3d4e5f6g7h8i9_0_ _X__x_p_d_X_*L_64_7(_8 _9_:_;_<_=_>_?_@_A_B_C_D_E_F_G_Ht_Ih_J\_KP_LD_M8_N,_O _P_Q_R_S_T_W_X_|_}_~_______|_t_l_X_@_54_7 _8 _E_F_G_H_I_K_M_O_P_Q_Rx_Sh_T\_VP_[4_\_]____P____+8rhlp|KBDUS.dllKbdLayerDescriptor+8+8+8 +8ApplicationRight WindowsLeft WindowsHelp<00>DeleteInsertPage DownDownEndRightLeftPage UpUpHomeBreakNum LockRight AltPrnt ScrnNum /Right CtrlNum EnterF24F23F22F21F20F19F18F17F16F15F14F13F12F11Sys ReqNum DelNum 0Num 3Num 2Num 1Num +Num 6Num 5Num 4Num -Num 9Num 8Num 7Scroll LockPauseF10F9F8F7F6F5F4F3F2F1Caps LockSpaceAltNum *Right ShiftShiftCtrlEnterTabBackspaceEsc_0 H` ll4VS_VERSION_INFO?StringFileInfo000004B0LCompanyNameMicrosoft CorporationdFileDescriptionUnited States Keyboard Layout8 FileVersion5.00.2180.1: InternalNamekbdus (3.11)t(LegalCopyrightCopyright (C) Microsoft Corp. 1981-1999< OriginalFilenamekbdus.dll~/ProductNameMicrosoft(R) Windows (R) 2000 Operating System< ProductVersion5.00.2180.1DVarFileInfo$Translation1333333333333334 444$4,444<4D4L4T4\4d4l4t4|444444444444444445 555$5,545<5D5T5\5d5l5t5|555555555555555556 666 6(6,6: dll\kbdus.dbg.dllMZ@ !L!This program cannot be run in DOS mode. $c'''~ߒ& &+܏'Rich'PEL0[8#  w&@mp3X@.text$& `ECODEqC@D* `PAGE9:n `.dataP#"@.rsrcmn@@.relocp8@B}@ C 3!FhFhK ȉNhC;C,;)C;&C;&C$;&[(; !jEPrYY3UM]I QK]S]U]؃Q}`jvAQ2yjEP\rYY3POOt fLH;ˉM T$.,T$.$T$. 0T$.4T$.T$.T$. 2jPIu EP_EuPEWPEjPu+E;}}}tusEnF٢}}F uEfFf-jfEfFfEEP"EEtEԉXEԃ`4ffH8ffAfH8f]]&E5gdN,;H$8] F4FV@F0ۻuSvd=̻;N>8] /F4F$V@蚗F0uSv =u;UN(f,HF$EPjv 颖N(Vm"Eȋ}UVuV+!F9E EPV3} FM+QHQP fN3^]T$SVt$W|$;s+@;ƈr+;s΍<+3ʃ_^[ f;t%}܋E;r%E;r%];NPh'wjEP4u};G%%VEF66E6F47} 66}t }03>w ~6NM}3C}+;3}6ȃEHfC}62x=E+eExW:f @w4q4qfqflQًXXf X\$ful$\$C@b EE} i:\Md:}:jbM:M::uDuD:$e2j;i>؅UT$w+5 wf`=lwtEtN&ukb94wut.(w+ w;uUuu uZTe$zcbUQe}SVWyu yF@8N}Etwd@$F@xw?yEulEwF4WN^ W%jjVhw5wtRy}u-jX;%_^[ DEyx@xwx5wwxwxWCy3룸8w@s8wHlwY;yEY6YUQEPhwwyu"mb4w3U4VW33=ww;(z9=wyhPwx*;ywWwwEj,PWB;yEPWhh(ww;yw;ytw@u WWhSwQ;y3_^;my3hxwk`| 0uj PPjh2whhw5xw$\8w+l lypyHȡ|w+;hyj^lU SVW3jVEVPjjjE@%;EPhwww؅e{ughjt$UVcuFFt3} uVP2NF E M HuVP^]NHUQSVW5w辉uVTMQPu ~WYz_^[UVuWF~% ͉Fxw*{N0F,HF4u5G EMH{d@0Vjp}_^]jP=A HT3Jj_]061EFq0F;tPhNfUQQVW33|w;{9=we{hw#;b{WWhhwnX;G{wwwbhwhdww= w= w=$ww;zw;z3_^6$ Sj m ;|SjSGhP"; |UQQpw|pwhPwtwpw"%LwhwE jY鮺M3Md _^[wwUQQdu@0u pnvbT$. +AƋJt JIuM3_^UQQSMVEW3PSuEig]w;mr;r3_^[S39hwVWPwVVpw=pw@AVe_^[UVutBWPwWv6=Lw(PrpwFpwpLw5pwW_^]UWVu M};v;ʾ}O0$Lw^w-:wwwPfFw;ÉFvujt$t$t$t$=0w髠EPEPEPVuJ)8wuSESPuEPEuPEuP5Gdu@0Spp;zTIyEjY+MjXE/T$.yT$..T$. T$. !T$.GKu$/EP=EjY=>BIUS]VWCC u ie ?FfV f PxdODX<DžtdGGG1O+FGFGF fF G%NffG$ff F E _^[]N @4|X}"u~E;x$Z33^Njx HGFFGff F 덊HxDX¡G;P$s@0d@DXtfFf;GEf}PEuVjPuK ؁4);!E;tNE ;;|9}tvF Pu d@0VWpj_^[^T$.$} Ex鉻EEM3}܋ʃUjhh whۀwdPd%QQSVWe38w3}u ;(8wf>?}}fvGIt A@FIu}]8wud@0w]EPus̐EPSj^VEpE;IISSuPEPEPuEpmE8]t.dh@0@ @ |x@5@w9]|EM܉MEMd _^[ȁ 8:wWjE^Pu[E YEWfuEjWWEPjjj 3WjEPju#;|9}uj^uQ;R wHhPwvWhw2D$D$3Ujh"whۀwdPd%QQLSVWe3ۈ]dp0d}9^ HwPc79 Z]Љ]9^ k/8Zu+M*9]ZMd _^[ UQ=wSVWk]} ;kE}t8Eu wxlb$'5w9] _^[%owew[wQwGw=w3w)www wwwwwٖwD$fHfffAPt$ t$ P5 8:wUjh6whۀwdPd%QQSVWhw|teExuPjMMd _^[hwvtVL5wT$.dE؋ Qj@0pa}PW w\ed@0Vjpe[_JJ;%$f2f\f/f:u<{EV 8;v3ҍN9Uv ~;k%+PQuuOfE fFE3_^[jhX7wVMpžxf`7w\\.\CONL$V3WADIP 9T$r x9|$r (F;r_^ Uuu uȅA+A EE ] ;PTRuPe Eff=ĈPvPF E;|H j h[wP 8wPEP8fEEPuSEPuO@MA4tfA8f=.fA8f=M)E;MԋIU Md _^[38wud@0eqËPU`E9E]EPuG?xOmF<tPEP]EjPS |EPjjSj\tMfA8f=3u u돍\F7G=w,wpu5 jt$y+YYúb,3;(_(3ω,‰04E^_3% @@ OMMO;ˉMtMQPEPEPjz;F(E9Eru9_t8] uhUEVp$EPE @PVmt uV+^]ed@0p >;t&ߋ?{tjC$PEP}ktEE}PE@UVWSuuu U[_^]]dv@0Sp_dw@0Sp_VUEPju u|,EWE}3PEPIufEfMH_ Ujh=whۀwdPd%QQSVWduQ3S@0p]ZE;jE]vʃM fH.f\HPÈ]MËMd _^[duj@0p^ÐwT$.rT$. @2\U˃PEăU; fȁ.8:wED$P D$$Pjh?BUQE eSV8Wu_}wE%uPEPuuĿWEPJE}VN;F=Bw}ءBwEu Ẽ~ v4eWuS( E |U+RMčAP;P E XMɋU+ffpuf$sEut3ffFFFT!MMd _^[]Yj%qÐ Bw\??\Awpd@0@@HOp3d yw*FI_^[M%HwEE;tEuE}u;tV]6+fEEfEGG}jEPu E;#|f97t}fufu}ԉ}u39U;;}EfEfuEf9uERjEPRujE]] U+UTQЉU܋U9U#DGEM+QWP PsW UƬw׬w5UwE؉E駸d w@0Q w QpA؅E^,=ww!EdO @0+OQ w QpAOG D=wDwO G+΋<ȃ}wmD饲f=A/Pf=a5PUjhWwhۀwdPd%QQSVWeE tHHQQHHPx}}exPMQpQu RPΘOpwu܅u؍u+]Q;QeVW}Wk ;}$>M3Md _^[UQSVEWPEPuuE3ҋ3j<_WEƋ33ҋ؋^j<33ҋ[E f]f f`fxfp _fX^fH [fPFGFGFGE^_Ðw,w@ Ã}jdEj@0pj T$.D$j5< w58 wp0B `Xw+ dXwхL$7]ԋEMEM ~ERPVWEUKu؃0uVW9~IIM;df9\uST$. :FE;ME}4EE:u„t_:XuGG@@u3뭋D$L$SU(VYWx;|$l$t#@wff3GGCCf;։\$-Ml$uCT$.jwUjh`ZwhۀwdPd%QQSVWdp0hw_Pe]܋E;؉Ew]EWu R } E)EM =,w|nËMd _^[hw PÐwEEEDEFE;FrgD$SVf~FN(Ef~FE(Eԅ fF2{fNjF[E܅fFM3uMMd _^[V|L%_^[ UXSVWdu 39w]]8]f9} @fA8=wD%Sf0c[ff=xNf=XL[?jt$t$t$Z7HL>+ep.+A ;r Y;r(E9ur+A EQU̅+*ẺE颟D$=#.fufE:fE\feEPEPĕq 0Wq 0Wà !++ C' };'f*EˍDAЉE't$Vt$t$$| >I|O=|UMU SV2;Wr2_^[] UQQVuW>M j_f99r#AC0f99vANJP20G;r_^Vt$ L$W>vFNJP20POwf>rvC0_^8:w#} fE)G2J>US]VE@Sww;~QF @=;r 2ۉq wJw(w@?wRu uPrЅ^[] f}M f f\tf/tf EEObf\} EU$E S3VW};Kj`EjPEEPE h P]E@}]]B;xKu uhjSSjV4)u En9]_KE_^[T$.T$.nT$. U$}EVPj(j|hE3ɉEE EMEEPEPEjPQuK u|}EM$^swswAUXPRNGGf?UE;rI=wFT$.D$8@HttȋT$ @L$ $,@3 u,dEj@0pyz3u 3u Ow4MtoU EVEEEEBPEu EPKA M"E ^HHAE'EE/ESE XE@EPnY3E@dEu}sE kEE魲E+EEEE;ANEy;Hf;9wUESVW d w@0hQpW!]C%}}MQPVju MR;٣ffCdK@0Q wQp }Ksȃds@03Vp%}3{f97YY+E uffFdN@0Q wQp_ ] Qu PJ f$A_^[]jj(j?GB^_[;GpHu ~;~UjhxwhۀwdPd%QQSVWhw2ejY3UwwMMd _^[hw2UjhxwhۀwdPd%QQSVW]Ceh w+2e3utFE܋N M؉HjY3M'tVjY3EMd _^[h w1ÐwwwEPuSu VPu?E;;t ]E@4bEPu~Eȉ]EfH8ftAfH8EjP耩9]Hd@0@ HUԉBUԉJUԃMԃH8]8wESIE; H]-f=@wCrf=BwNfBwf9@wUSVW3_^['E\nUjhh{whۀwdPd%QQhSVWe}}3ۈ]ԋE i]؉]EEpuN~@t2]EG uSEPVWq#uE;G R=SfG @"UfvDxE9u!Uj[]:X3ۉEPUNV HMЋEH(Ef;E]ME؋Md _^[ 8]ÐrwsrwrwUMVQd@0j^;pd^#E A]dE܋@0EVWp}VW}uiUjhH~whۀwdPd%QQXSVWeEE3 Uu;a?] X] ip?M}?;?xH#xL}<9tFUux-E] E^]ԊC7?b?uS+ʉMM;CuuuSu u-5E AfeCCAuE $Pu+u܅t^FE@};}rEPuV ;}v!E tMU+3<2ʃuu uuXA;pK>p>+ECUM;E@ >9uX}AeMEMd _^[}tEx:,Ð/~wWwqwwwT$.f@@Efuf90u@@EuHff;El]PvS跫 C]f#CC]E+PWS菫 euuu EP ArUSVWd}@0Bw3ۍLQSp3;)BwP5BwV PGPBwQE pff BwffHfNM;p2U;(_^[]VSًt$|$t+~Ѓ3‹ĸIuڃtFGKuD$[^_UjhȀwhۀwdPd%QQSVWeE EEE32ۈ]܉uEPjjujIE;?EȹMĉuủu!}_!E0eMEMd _^[]wkwE;MB T$.B^_[ø7T$.T$. T$.b w3;wwww wUQQd@$jjw5w0MeEPjE肁EE 9E R C Vt$W|$_+^ø-T$.}9~FE؉}jh EPWEPjE;|E܉FFMȉN9}FE;FEjPEPWEPjBE;EMȉNM9}N=wd w@0 j QprfO8fO:ujxY wHuwwH wHwu 7 PZ6SVWD$Pjhwd5d%D$ Xp #O;t$$O4v L$H |uhDguTf9t||x|&EE|j~Ex& jY RUjhwhۀwdPd%QQ,SVW3ۉ]8]EjhEPSEPjG;|M UMd _^[w;f;Pwu 9^,$dN,;H$ N($EvupלUM SVWffE tDu^8;VWqBSTfE fff;Fsf${3_^[]8:w{ÃImhwmMdT$.t$UjhwhۀwdPd%QQQSVWe3Mt0t+!Ef9MZuQ<sE8PEEMMd _^[vwzw=3hPw!$ wjY;I9=wu9=|wu 3;jjvu렃}ԀkSE@iC 3_^[USVu WV<j8bhwPǺFYYH8F?NPhFj NNP28^vFGGf?tE;rf-GGW++Qj tv|k:^r}Pu%?;+EH;f}MMQPf}j3_^[ UjhxwhۀwdPd%QQ\SVWeE 3+rHHaOHHU]fU}M;3u 3u 3KKfuwf;uЍu+9U;uU<6WS]S ;u}f$;M3Md _^[w!wS-1-8ww)wwwUQVdH0E8PPP PuI3ҍQf fff &fEPtE3^D$8fHŀT$`tP|$ fH-3 3ɍCf!M~M}vXtfMfMf}̓EfeEfE fEEPEPu^fMMjZw+UڅT)M EHEbfU魾D$@ÐEEE50P (8PX700WP `h````ppxxxxD$ V3=w]}L$3^ fz_QRfzR3It 3IuD$[^_BBFFf+fuOfBBff=0f=90;E { uf.dlldEuj@0p S\$VWtAL$T$j R4_;Jσ+;ϋ#;#!_^[ UUM SVW} ;`XHًO;։EU@w ")w"_^[] uu}*oz t@;b%B%@uE \+3}ʃ>T$.$T$. UWVSM t[u} hwxAZ & } uFG:r:w:r::}rً[^_øXT$.(VWt$ |$L$t1zL$t-zD$_^ UjhwhۀwdPd%QQ SVWeeE}<<GO;fEf=לOM܃eG9ETMMd _^[/w/wT$.UQSVWjEjPj5(w2|uww_^[FGFGE^_UjhwhۀwdPd%QQ4SVWeu軺3}u f%?PuE;ѥf9pǥ}܋M;M;];t7p u};o}V PS f$C7Mu>E܋Md _^[9w9w80UjhwhۀwdPd%QQSVWeu3ۉ]EP} W tf9ǢEPEPWuE;V9]EE܃Pcu;t]fF^ uWF P! EF f\F VuٸVfFfFEЉ0E;tfNf]ԃMuEԋMd _^[ 7w7w3MẺEЉE؉EEEM jZffۉM Cuj_}3f cfxbÐw(wEw$wwS\$ KVW~'|$t$fWt$FFPT ?tK_^[Õ5wĕwknwnw/w/wQwwT$.;FG:tHM  VP VP VP VP VP VP VP VP VP VP VP VP VP VP VP V)}j_F醝L$Q\d$A Aefd|gEPj qEQdxM;6Xu3fMfMuff;tf==um2髽wwwL$SV3Ҿ:W3ҿI7iOȋkdK3ҋiTqȋ3ҋ؋kdiɴ:+K _k^[U SVEWPEPu]Mj3^AQu fV]jd3i+[3һY3+}jd3_t EwEE>w)EE3ҋj<3[AfE EE 33f~ _EE EU 33҉EEE@fFE@fFfEfFfE fF fV^[ EUQQMSVuE`y^jjjhSЅ 2^[UMSVW<<؏A9E ˏE39u Qv y;zF;u 8rQ9%? _^[] T$. Vt$V<~~j Nk XȍD L$ 3^\REGISTRY\USER\HFEFB FEF= F)D$ S\$VWZ+_^[ }2E+EH\HHZE}veGf%EEȃE Eȋů]܋MątUMt}}k} fP UpufGuҍ4։ufPU3f;p9EEDE wuU؉U;unEft@ukk]؍v Fv$vjPuۉEtucE|6EE;Er3_^[U} } EM EEE3QPPEEPEEPhuELogL$SUVt$W;2_^][ T$.UEPEjPju}v}vjh'uu讙3Ɋ8:w6uf7GGjV*YY ΃0; uM;urǺ{$3wjP;Iw ||L$AL$ d S\$ǃǃǃǃǃǃEEE[UTSVuW33E@wVF(;/N(d@$F,V_^[O~@F(C~!F,F$ziF*~F(fEPv(v ~1&3f= mM$9}$2Df= fE9} f;%fjf=%IYj Zf;[f= uPj鳤d T$zB A$B B3T$3JB JZST$.T$. UES3V;Wu^ȉ^ ȋE(F8w} ;VV5w;EE;F _^[]UQSVW}'=w`E ];`Et 5Q ffVfP;E 8pGUH `_^[]fzf1fzf1D$vff+L$f#f=9C:UdSEVPjVj$}#=|}EPVjiEPEjPPju4uEPuh|mEu"f&fFPwFShhwVYfENfEfejuAEEP;؅fEf^[B)<0o<9o0;)toUVuW=dw3f9OBWPjEjPA^%>fE_^]fMA @(f x:vWF8V GY(WPNDXp8RPffYYY~UUS]VW;Sw'}OM4UNM2_^[xEEx;@N98u/L$9AT$$,@t6fAĀAt T$ AL$$,@3d@0pP d@0pP$UjhwhۀwdPd%QQ$SVWe}u܀eeEG*]؅mehдwV_t9E FE uxEEhwPV6EeMEMd _^[ }t xvUS] VuK$u,C<@DXݔ;X Ԕ;X$˔”Cu#2DXp;X p;X$pE } ^[] wwwRtlValidateHeapRtlValidateHeap;t $E EȍA$EyE#@T$.A$9B 7B3W|$Gt Pw3_UdMt Q]w+w;KfwfuRw_^][dT$.UQe}}}u YDPEu PuuzEHUQQuEPEPUHSVu W3Fۉ}}u  jZÐScni:nHH]}QEP[fEYȉM>f+E}_]@Ku+u+u uEPuVj XEPEuuP誰}1EPuuu肰EYE_^[VW|$Or_^øCT$.fz7T$.jt$t$t$t$#FPF߮ @Ǎ<ffu L$SVjfYQXfttхtB $QfttхtR 9.Qft ).хt R^3ɅI^[U eS]VWEE龀xE韀E_^[UjhwhۀwdPd%QQ$SVWeuuЀeE Fi?3}ux-E}EVXEԅt 8}܀eCeME܋Md _^[}tExÐmwawowT$.f=03f;1f=r2f=n2f=t3f=b.3}=3M$9}$(4fuj tU=wSVWEU ;*8E=Eu 8wxw$ w  ^X ^X ^X ^X ^X ^X ^X ^X ^X ^X ^X ^X ^X ^X ^X ^j+_D_^3[] wwwwwںwкwƺwwwwwwwwvwÍx9?jjZ≕MX=GT$.} +,FEPEP{]ESPu1;|0EPSjuS1tMfA8f=u ufGE9EruD$8:w 4-II$`T$.0PjWR%r%i^_[3fxJ3`M`ejD$8ifHŀfT$`tP|$ fH73  gAEwEE4we pT$.Vt$Fh wVGtF ux^Vt$FhwV tF uxw^RtlLockHeapRtlUnlockHeapHT$.(Udu@0jp]x}vE餻Ujh0whۀwdPd%QQSVWdx0hwetQMfI0ftE;w>tu^]+@EMt$$Ef`0M7Md _^[U E VEEEE W3PVVEjPuEֿ;?iEVPu uJy;'iuNH*U;r ;Qh Hu}*U$SeVWuEPnufEffEfFdM@0Q wQpFMQuPlif} fw ffGdO@0Q wQp'؅ۉ_qwP5 wS iw؃ f\ffMMCfMENQvPhw EEEEPE3jPEE@]]2;xzE_^[ UjhHwhۀwdPd%QQ SVWeuN399ҿE8M ;nEMd _^[jw%jwUQQUSVWCH3}9QG;}vQnn=wFM3Md _^[I] #ω yfaXfa^fz_R ;l$ŦOT$.UjhwhۀwdPd%QQDSVW3kȉMIdQ wQ@0pE؅d@0X ;=w;tE؉EwF5@N5@?;u39EEE"T$.UjhAwhۀwdPd%QQ,SVW=wc+dX0=wd@$wwhHwedE@0p }+8CC x }؋C ;*wu܋}؋F9CtދNMtԋN4tɅtf~:Ljjvu`w멸T$.+u rM3qDtH|HzExu Eh^_[]fG.=@@pff"f\!f/u!SUVt$WhV3;^fv;So~4SUUFWPn0kG;:SUUF WPnSG;-n$n(n,_^][W=wSw;pϋ?A<tdI@04jpЋD$L$V+@ <`^3Ҋ8:w)G 6;[~F9GtN,u݋^tttf~25{=wujjvSWu릸T$.Ujh@whۀwdPd%QQ0SVWuuĀed'3Md _^[woT$.D$U EVEEE EBEEPEuPvc ME EME ^øT$.EщU;)EщU;rxuԋ靄V)<EM~@tf~ȁ{D8:whBwca8T$. UQeSVW}f7jVۜYYf-f+]$ܶ3ENhVuYYUu OO uʃu 9Et> E_^[øT$.Ë?;|Gf;wiL$ A;D$qPQt$` 3 UMEV;Ht9Txw9uL|}  nE^]US] nS蔻4fHf 3Puuu S[]} N5f}XGEPEPOu3ۍESPVz;|.EPSjVSy#tMfA8f=Bu u Xf9_w]%f9^uXMȅũĉu܉uȃ%,wfF<MV@U QMԉMM؉MUԉN@E؋E܋x}@6E=wjjpWqEvupePwẼehVsĉu܋]̉uȀ=w~vj'`EvQ39~(t F$P9~0t F,P;50wJ_VWEp VwhHwøT$.UTSVuWV33E@wMF(;iF@F(Vi_^[jX5oM;bIM܉UԋQI UʉM M9Yt׋M;IM; ;Ur;U IB$ uuA tF$s ^@@ff~f;L$urE;/<}ttVEPoXMw M;M rP5 Mwuc] WSMwuQH] 3 MwfEH/=Mw}ECEm.O(;O$=PVW+鴭D$8ofHŀo|$offH3uEWEjhRPhEEPjU>5;uWXE@uDDDDDDDDDDDDDD$*wBw/w'wwwwwwEhwPwYEYPrYDE %sFGFGE^_FuЁQvPtEԅt3lUVu< a<aMI`I`} `EPV x`NE M`+ΉHV+щP3^]jt$t$jt$t$UQ=wSVW.DEM ;sȋEMtU8wMMf9~@SuvW f9~v Ff$XEHwEܣwEwEУ wEԣ$we"T$. UjhhNwhۀwdPd%QQSVWE3;t } E0EM@EɋꉕxM;ARf908RfLHf $=;RfDPf=\cf=/cƅtEPR;M fMfe3}ʃd@0p$Sz|MeˉM3}f}f}҉}ԋ|HkHOFfP>EfP2E8EuVLbEfUE؍ 0M;M Eu 9EOee9}f}3҉Uxf9AtfˉM]Uf:fx׃.|Jtу-t fˉM]Ufftf;tf/tf.ucUQQSVuW3viy|aNEfffM؋f|^:ftnftqf.Sjf Ij3f<АTQ`BBf f=l҄f=cȄf=pf=af=n3_^[f/ofoBUwC$EĨVM4ˉüFfNSV;+}f cO]ЊCuFCK H;u1ff=s(ȋjZ≕MX0C E)H( }[f>F5f|f@ @fsxwPNV HEx(=UQS]VW3;=w}3>d@0j4jpq;ԱE fN FEFEFEF EF$EP;ljEEwwF(d@$F,xwEWWVhw3pd;ljE}E_^[UVuWF>bGNV LGGN~$Bf_^]UQQSVWwWXww;dDz@ѿBEM@EWN3_^[f ]}};Mρ*}Y];EU} CI;vU]􋼽339EPQEWPu$VR])E$}$B4F39}y+EE@T$. u%Ef+F1U$SVEWPj3[;j@E_|0E]܉EEPuu}uuu .EEP9uxE_^[U}M SVWVu0Ujh@whۀwdPd%QQSVWeUB [À-c+Z} qj _3<0&3+-eE0M3Md _^[ wwDT$.UjhwhۀwdPd%QQhSVWe3ۈ]dd]ȉ]8wud@0uFE]ff;+\@@Ef.uE丿T$.D$3ɉHf@f@ H HHHHH U,wVu Y9pYM ^]jjLg^ 7G]M@vWh `w}P@FGHu_^USjuE3P譂;|4jEu P蛂;|ESPEP ؍EP7uEP.u[5LwEPE]܉EEPuu}uuu nEMwLwwwPw\Registry\User\.Default\Registry\Machine\Hardware\DeviceMap\Registry\Machine\Software\Microsoft\Windows NT\CurrentVersion\Registry\Machine\System\CurrentControlSet\Control\Registry\Machine\System\CurrentControlSet\ServicesT$.Eh>wP^6Dynamically Allocated MemoryAAf9uT$ f2f1AABBfu^é>3E8:wrUQQ=wSVW@8UM ;щUsʋEMtuwMMwwwwwgwfx.#4f@f;jiT$.T$.U E MSVp3AEWAE UUr ,UM39u|9u Ef0EBB;tE;|f_^[jt$t$t$D$øjT$.UQS38wVW} ]@@=u8]HfKfFf;PE wPPv;FM E_^[ Im3fm3ӄ3EĀN6AE9EE؋Mȋ4uEȋ~}3ۉ]dE@08XdE@08Xm9]=w;tf~:)ujvWUi?&T$.8ll+E<}AE&= o} uE3u3҅U;Uw;rU+E;ʋw;r+‰MECCM}-hf   - ; ;ё ;O-( t'Ht$-׏-t-f-H3 P $F#шGNO"2$QwGDXx8 L$SVfAAfu\$IIKtt$ffAAFFft Kuf!^[éE3E8:wPE#\)=T$.UVuVuuus} t}tuu 6A ^]t1|9n,1$QwÐScZsi&=nH)H }FEP9E YȉM=EEb+EEEE*}]@`u+u+u uEPuVj EPEuuP׫}tEPuuu賫E}~E]x5wESP< E~EPuu.] OEEPuVj (t$t$'Yf=D$YҡVW|$O_^ËL$AtD$fËuً˃+EJOjjEPjujJE*M+MU+ȉM;M!\C]E+PWS> KK]f#Pv+S> Wh@wL馍UQS]VWSoEu<EM E:EwMEEV3EEPVZ~EfC} qEF;^EULjWUfHMHSPCPEfF3_^[jt$t$jt$t$Rd T$jUTSVW33d@0u3;Mdщ8wvw%@w9^EH@u@Sv袳=i;8]vo_^[fz)E@ @4lwfIIMJJUffE1`UjhXwhۀwdPd%QQSVWe} Gqf8q}FGfPuxH@w3;q~jG,Pu -qE8Md _^[d@0@hÉM}3T$.;FffBBFFf;?;T$rbFQD$L$ SU(PVqW9;l$|$ A€|$ D$t;"F @wff>BBFFf;߉t$ EfaUfa f;E+_^][Y E^_À=wMMd _^[hHwVWSD$T$\$ U@3; +#+Iu][_L$ 1^FGE^_Ã`l`U˃EăUEăUfЁ(8:w+} f%tT$.=wT#MMd _^[hHwιVdp,*^Ðw+69jE'ZEE5ÚY35M3҉UgQU;`f9W|>\jEPڑtdSj@0p̪e2NPQ R 9QPPfA}3E8:w+PMԍ1UWVSu }hwxJz t.F'G:t,A<ɀ A,A<ɀ A:t[^_Ë1 0_OPEP~E+sM@OfVpfE=fufE:feEPEP~EEЋEEԍEPEPjEd{E艅hEMfA\fE2U\SVuEWPE3PfE=fufE:f] ~Bwf]fEEEEPEPS;}hBwfE5BwMȋfEȍEE]E@Eԉ]܉]dj!Ej(PEdž(PEhP;É(`u蔑_^[Zuff=1f=9fj0Y+f;]eOf=!;fE%EZ@6 j=we jT$.lT$. d$9A Ҭ3U$eSV39u WjG3Y󫍅DžP;hE]f9uMEj^LhE}rj@SuhM}Sh>Ujh8whۀwdPd%QQ SVWEdx0}3ۉ]u;Ձuf9tz=HwQG;pHEjhwu .uf wf wf9F6P5$wv4 wf9Fv NfA]̃ME̋Md _^[ L}2ÐwUS38wVW} @@=u8]HfI4f;NکPE wPPv&>;éFM 3_^[] SVD$ upL$D$3؋D$ ^[SD$ pL$D$ 3D$3[hwgUEVx<p<d^] wQ=L$+ȋą@PUE SVW%UpfJzf;}f˃f f;Js Mf$A_^[]U0SVWd@0u EEPj jvEPjj}vfG}f4f} u SVuE}V{ KF{ <tڀ=wǝEPEPvWu’=we ;jC_M;ADS39A4 @鐝xx駋AT$.SQwMKCk Y[3Ujh^whۀwdPd%QQHSVW3ۈ]ddE5]8wud@0Ӱ0w;zj,PuVlFE]ff;c@@Ef.uEf;NeyUjhPwhۀwdPd%QQtSVWedp0u3}Љ}=wudx@0w=w'EPuMfA8f=r'HfA8E@4tWP(=w=wPwu TwPwF x }̋F ;&GE܋}̀`5ߋEfx8u؀=wEȋHMċPU QHMP U QH<Up@ur=w}G]TwUP@ Twuefz.{T$.$UVuF% ͉FxwIF]d@0Vjp蓠^]UQQEVWj 5w5wp0tj5$w5 wVWtM Ujh\&RP:+E8u_^ ,eXgP+EP^j@nU ESVWfHfffA0MQMQMQMQMQMQMQMQP>EU0u(jY90};>0}];0} ];0};:0u QuV-Eff3ۃ ;É^^^ ^tH}$ QPWT- ~E;tH}, QPW0- ~E;%0E;tH}QPW - ~3_^[,c>L$SVWi3ҋ3ҋi_w w1^[ A| Z B:u'+߃@+2R3Vt$~$jv^U=wSVW] u;oEt 6wEMw$Bwxfrf4qfp<rf4qfp:rf4qfp8rf4qfp6rf4qfp4rf4qfp2rf4qfp0rf4qfp.rf4qfp,rf4qfp*rf4qfp(rf4qfp&rf4qfp$rf4qfp"rf4qfp rf4qfprf4qfpr f4qfpr f4qfpr f4qfpr f4qfpr f4qfprf4qfprf4qfprf4qfp rf4qfp rf4qfprf4qfprf4qfprf4qfp2f4qf0;._^3[]wwwwwuwiw]wQwEw9w-w!ww wwwwwwwwwwwwywmwawUwIw=wSQju PMfm EfEKKFFf>%|}|߃} wlPrEtejt$U eSVWdeux$3ۃ} Å]w@N} E~0wxwwEwE F;x w3wwwGۍM#SPVhwp{V؅w}t uwtW]wE_^[V议USVW}3;|uFvNF EMH;9] t Su _^[] ;+Ǎtȍ|ȉEȋEȃBK]MHb3_^[UTESP3ۍESPu+:EW}f;VE]EEE؍EE܍EPEPE@]] d@0WSpA;^_[D$j5< w58 wp0P[ Pw+ Twх]L$fFFCCff(f=;u(;M ڶEEH$M@(E8]F4E@uE]Pjju;}EhwPEI[EjPEP訑EhwP$[EjPEP胑8]uSu:;ÉE|[h{hSh"wu:;ÉE|9V5NH;t+OE3`(F]DX8p8f>fC @fs?Ǎx09TP i3qUSVW|w@]yjjEÀ^jju jVhw5(wEej_^[] JwNwf ,t ddM@E E eE eE@EPhYE@teeEu}eE QE1UVu 3;:|9M1|8|E u PMfE +^]øT$.FzD$L$@AUVuV脂F(HF(u F$+V葂^] {}܀=wmEPEPvWud|}D|E ;HDM=w mE EE]@9Er6U$S]VW3uNMSE;Su ЃeU}SM[؊ C (w ]TE ()w8:w;7pw;X(w3]=w"9D$ wAÃ=w?9D$ wAËD$Ѐ8t a}B:uÀz =wV7Bt$wpF u^W|$W$MwZw Zw4Lj3Y_G 3FuPEYYu3UPM SVWfjZ3f;މuuM tj_jE_^[ÀWfzK s1FH<@uȉMFf@8fEfESjhwjh|1wEP~hSjWjh1wEP;} 8^bGb}Vwhhwww wVh w=VwV=V]tw^ËD$St~XuvH(tȉH(H4tȉH4H@@PVE@PEPCWu EpPEP/Wu$ExPEPWu(EPEPE,f986E䉸EfEfuAM}ME̋Md _^[(y9}<ËD$St~XtvH(t+ȉH(H4t+ȉH4Hw6>wu+;};~};t}gE3ҋimjd3[3һ+E7S fjd3_t EeE>wk<Mu Ek<MiMQVN_^[UVu3u E |gE~gEeRȋEe $hg^Ћ] t$jjt$t$t$AT$.CC;utf~\tf\FFf;Wu VE ?jf$>ujV#o uT$.U38wEM3] VjVhS;N+*UVuW~~_^]ff=.t f=:tBB;r;vfz B^+f6fEKfjE^VhswP!hDVEhswP hrDVEh`YwPg[DVEh@hwPgQ?Df@@f\tf/tf9uEPEPV趀E9]EẺ]]wGjSEjPSSESPju(;ÉEwuPEu;ÉE|#; |Ef^8vF4EȉF$ẺF(EF,EĉF0T$VF#}@{E@ tN4F4|E}@0=wp}uDE_^[T$.UM ͌UdDIt эHJu]3Ɋ8:w鈰T$. fx\.fx?#fx\EFD$@ؖxtx ϖxŖ3wWVS3D$ D$ 8# I#L$D$3؋D$O[^_=w|jP鱄U(ESEEEEVP3jjE]܉]]]E E];|FG:EMtuuEt8Et'UESVu W3>HP;yP;w_^[]D$L$VW:u4P:Qu,P:Qu$P:QuP:QuP:Qu P:Q2_^I ʉ~UlSeeeeeVWEjPEPE)EeEE }f{f]C @pfǍx9u(j[㉝ M XPtD$Vjf0Yft$ +;tff+^f#ËjT$.uf pEBUfM9usMf Qf\̱f/ufMMMMf!j\Xj[f!ttUur;v Qf9!}+fEQU3;vf2f f.u;բMEMd _^[dÐ[Nw9}IYf$wD$"8AtomP[D$P[3Ɋ8:w"E;pHMf;wopE DC(U 0E1jZff f!]fLU;Af*u@fftf;u AABBMu +]U\M SVW3;}Љ}ԉ}؉}}܉}}}}ĉ}ȉ}̉}}}}}}}}}}u0]'v;;(Eӗ] `" '9U  wU'}o39Et 9E'}'jXUM;O;M*(EMMMM5E̋MEE(EMEEME Mt}Eff='f='t#'u '2_^[ UjhDwhۀwdPd%QQlSVWeE S3u@EIM@@Ef8=u*;}t2+EfEЋEЃfEGG}߉]GG}f97uGG}ff;f==uxw{wwWwf.&Uf2f;Uff;҂f/˂ÂT$.@ T$.,VWt$YtVw|$ GE%Vt$P fwf7_^ W`a yo+VMVWLNOPb 5OT TWW2X.W TWztWW2pqWWW&"WWz%&+Wq{]] W *WWWWWppp!!2 !"#$%&'()*V,-./0123456789:<p=>D?@ABCDEWy&23456789:;<=>?@ABCDEFGHXFGHIJKLM,-NOPQRSWWWWWWWWWWWWTp UVa d =WX YZ[\]^_v~@@3;;;;Z|Vm^`abcdefghij]Ybcdefgh_]QRSTUiXklmnW]]]kr;;jD4@@@D;;;;;;;22ls*+tuOs" v&)*(wxrhijk                !'Q$ uuv8!9!:!A!B!C!D!E!F!G!H!I!2Q!R!S!T!]!c!d!e!m!jkl!"z{#$%&'(|}~YZ[_`abcdefghinopq{~\777hYwNULE-'3SSPuDžhlDžt@px|j`jPhPh XP[dS@0p;B;XhjSSjPBX@+;`jSj`PSSSPj *;*\;d@0x ERP+]fEMf+if}f fltfctfptfat fn {э4A;F3[^9JU}fE fEm}mEUjP観/jjGFg^ 7]M@vWh `wd <fEj_yT$.FGIA$u# $Eh2\wP~YYGWh:\wu$VBk}%s%%%uUWVSM&ً}3ˋu F3:G_ы[^_YB;U}US] fWV31[fa:fa{;2_^][ dU˃EăU;j-d@$F dmEE]ۋ]jQVjRP ;fE܃fEހ}hE饐T$Vt$ Wfj2!~jX_^øT$.f=A U}3m@}uU L@E] Ue}d3m@}uL@E U E]D$SVWff \$f;ftf;tFFffu@@ffu _^[Ëȁ3Ɋ8:wPfFw;ÉFX? s7=w6jWVuls,fCfW,}]؀=w]5EPEPvSut/,}E;HD=w5E ef_]} ]qEPjjvaj`u؀NUjhawhۀwdPd%QQpSVWed@0p$3ۉ]]]8Sd@0@(Fȃ]E~}dEWS@0pR7E;;f]f}u uE;;EPSSuWur};m}SSEPuE:OEȉEE]EBEĉEԉ]܉]Fȃj!jEPEPh EPTE;jjEPEPu9E;E";Eff|x\2fx\f\xMyf}AAQPv4 f>F;tP)$EF]]M3Md _^[39]td|uS@0p:9]tdxuS@0p:9]:VQ-w1wwawEU@ HBUJUMHUE;t3W}VS]rSWRu @AMt;;Uu[^_]uuuV$d@0Vjp9à !!+!HH! U*!EˍDAЉE{^TEPuVj0TGTt$Vt$t$ >pTOdTd@0@$ExučEP Mff;EnfEjEPQ)DVM+|VfE+fFf8\8ffFAFf=AH sff=ZBBFFL$S8fJ8f;A8ff=ZwOTwEEPu u%EЉ]}UVW}WW!3t6d w@0jHQp3txNPH NHD_^]UVWd@0ux F0fP!HN<Dw@wV@ HOG N1pWGNV _^ H]t$ @(tD$Efx}ffC]܋uNf=@w8f@wfEjuEїEĉEf}t!EM;uEE$ewMMč}ĉ} EE6WWVuu;qgE4MuE؋Md _^[ H8wV8wǺ +$jwqwWlw"wUS3ۃ=wVWhPw)?EC w+ 8w =w ;  b94w |w+8w;uuu u虺hPw>_^[] PT$. 8T$.(T$.5D$VWf9t8@@fft,L$ft+f1ft<+uAAf<u3_^8w"hHw=mT$. ;ʉMEN F;Hu"ff=sjZ⍄X0F;t;e=wd@0pTwK_^[jj,hwj@|d@0@Iww3;utuM;utUQjEjPjuUN;EjPjuE2;UxSVu3ۈ]]]]]EbYDPf`w5wfbw5w(;ãdw:u`wVKhqwV@hqwV5ShEjPSEhPEEEE],;EEEEEEPSSSSSSSjEjP]]]E ]̉]E(E]@EPEPEPEPEuPEPVhwzuXbu5;95wmd@0MHLd@0MHPd@0MSSHT5wEuwEu+Eh0w!;ã,w9hrwh$rwSP!V4w3^[UjhqwhۀwdPd%QQSVWeedp0u3ۉSP|Pj EPjh6rwuD=lD}uIhVrwpPffDžPpPS衃;FMd _^[D$wD$hw3ww/w3wUwYw\ApiPort!CSRPORTCAPTURECSRPORT!ApplicationGoo_COMPAT_VER_NNNq}z0$dwEPuVj0pxwfznfz /nfz+EnT$39t w;BU=wSVW} R@@H3;K=Ru}fLf;FbPE wPPvGl؅UWVAq<>3_^[] UEeeSf8VWu 3;WPV?|fff ;lj}E L~=ws%j YjXtwE .t6}scEG9Er .EtM_^[ }ʂ} +MIE뗀}두8T$. tGIuH P\fz!3lfz?Ilfw@6 =wx~'|jEP YYExT$.UVd@0jDjp!_EWFE FEF EF$E@}fN#EjY~F(F,N F0G$F@$F8d@$F<xwE }0M@jjVhavw5w_^]UQW }G~"VwS5w;1V]MQPFWP9t/96uEPSVhwtju5wO[^_F:~at :At f:toG^[_PfFw;ÉF=S(]EE'PNL$WSV|$<q%L$F:KtF:wQ>w_>w?w?w?wAw;AwIAwBwBwBwCwCwCwDwDwDwFwEwEwGwFwFw$HwHwHwHwHwBiasStandardNameStandardBiasStandardStartDaylightNameDaylightBiasDaylightStart{%08lx-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x}?5h!>@@??(null)(null)_yn_y1_y0frexpfmod_hypot_cabsldexpmodffabsfloorceiltancossinsqrtatan2atanacosasintanhcoshsinhlog10logpowexpPageHeapFlagsp,wgwSjhHwjhwEPwݜE lMEPS/t8wtDSjEPSwj E;}P#ut郥E ?EEjXËeEEEP#3#E)8]uu#u37T$.?T$.ET$.øFT$. JT$.LT$.øMT$.NT$.QT$.RT$.ST$.øTT$.UT$.VT$.WT$. YT$.[T$. \T$. cT$. eT$. fT$. qT$. uT$.vT$.T$.$T$.T$.T$.T$.T$.T$.$T$.T$. T$.T$.$T$. T$.T$.T$.T$. T$. T$. T$.T$.T$.T$.T$.T$.T$.T$.T$.T$.T$.T$.T$.T$.T$. T$.T$.T$.T$.T$.T$.T$.T$.T$.T$.T$.T$.T$.T$.$T$.T$.T$.T$. T$.T$.D$L$UMf&]UQeSVuEE@tEV<&t<.t<6t<>tuM^uf^dH VN@$VF @w.F .3鬱3EMf fHPQu萱aD$u3jhRPTL$QVW|$tD$t$ HthX_^ ;5wv hXL7D7ًL$tD$ PD$t hbX D\DbgSsApiPortUEh«wPEEE#3PPPPPEPEPhw=UE Vue@eEEWjMEYE}PEh5w=_^ UE eEE@EEEEM@EEPM5w UE Vue@EEEEMW@jMEYE}PE85wE_^UE eEE@EEEEMEEP5wB UE eEE@EEEEMEEP5w UE eVu@EEW}E$EMEEP5w_^ UE eEE@EEEEMEEP5w^ 3;|8D$QXwD$ QQhOwDwD$QQQwD$,QQjw3U S]VWCwt S=uEd w@0hQpЅ҉Uu 9E COPu ,_^[E jYBxC3+HHtyHtfHtSHt@Ht-;}Cdu@0Wp9} W뒍C PCPRȍC PCPR1븍C PCPR먍C PCPR}똍EsPVDw;|w;t)MjQV;|EC EWPVw;|EC4C PEPVu>w;tMWQKQ;|EC C PCPuD C PCPRS5XwXU(VW3EPWW5w2;|9}uuEFFx;tWP\+d@0VWpV5Xwݐ\DbgUiApiPortUVW33d9$ujEhwPEEE#EddU RQVVMVQM$QP ;|d$W_^d$DBGUISTB: Waring No State Change NTDLL: DbgUiWaitStateChange failing with status %x UVWdu j ftf,tf t DGЃ2 u׋2f>,u2 _^ApplicationGoo|jv};ƻ|P|WjhwuP;}WSv=閻DžDž]EPSSjPvM;|2EEPPuv>M;|ƅ_?}[ECESx9EvEuQRhEME9E;+{WjvZ8H\WxCPQ2s \3 Pj4HHfH ffPfffxf f9HxW2YffPjvt WP[YYEujv63>jXËeMu}3jXËeMu}3-ejXËeDžMu}ml艅ddPlPdPlPdPlPtfdPlPZ3ɊfdPlP8XEp.8EjXËeEp 8jEP`YYw@fA8vMvLDR: UNINIT LIST (%d) [%ws] %ws (%lx) deinit %lx LDR: Calling deinit %lx LDR: Unmapping [%ws] hw-Y8pjp(p0wPhw ED8EIMHe5Pwu;_Wh4wʾYYEJjXËeePwv0hPw螾YYnLDR: LdrGetProcedureAddress by NAME - %s ORDINAL - %lx hwRYnvh&w?YYn oVh2w#YY_5ujEP螿YYouSyE]uoEtjXËe苅tE3ۉ]}KoUjhwhۀwdPd%QQLSVWeE$Euhj3SSjEP;|0]؉]jSjEPSSSEPju;}u"ƋMd _^[jjEPEPu#;}ujgu뿉]8]tjE8]tq9] tl]uuE;tfNfEPjSuE;t8E@ ;t.MQPuV 9EPuU EuuԑE늃Muj|fuG8][!QjXËeujPfuM!Ujh whۀwdPd%QQ@SVWdx0=wud@0ejXE9E sNE3u]G H ME9};}́EE ;Es#Et?ҋ]#sue믃fGFG F G4FfG8fFffFffEE;EtHMfF;uFEfefEjG$PEPbEEԉE;EvHEt \u@E+EfFuMEEtM܉MEȋMd _^[ =wud@0sUVW}wGEMH}gS^St9OHNYYv(hw/YY^d@0HkËE %G(;t Pڲ#镗}$| }.sFEMHRC1EPjH0Ѕ}FEMHR1jjuucEUk]uTRTL: Enter Critical Section Timeout (2 minutes) %d RTL: Pid.Tid %x.%x, owner tid %x Critical Section %p - ContentionCount == %lu RTL: Re-Waiting :td w;H$q^^^ ^d0Wh$w詭YYddrVv q$p hXw耭Gv7d@0;t&d@0p>f@\f=tf=t%hw6YEEP]]E`wEu.P|/Pq/s)Uu$u uuuuu ur] Uuujjuu ujʋ]Uuujuuu uj訋]U(M S]VWM3ejuuuuZt+f{C;uE@ #‰EMet2fCtfNjC;uE;t @#‰EMet.fCtfNjC ;u~u E ;t @#‰EM܃et#f{Ctb;u\uE@ #‰EEMMEDM;Ev1#_^[ÉEÉENÉE {ÉE렋ujV@Mf ~}~t)}vuu WSǃ +}F C0f F}t)}vuuWSǃ +}FC f F}t)}vuuWSǃ +}FCf F}t$}vuuWbS +~Cf F3U}tjuuVEx؅|$wuPu聼3E;u;3;lEM9ut uVu&_^[ )9u uv}Ep0 FHHu#E E0FvPFPWu>؅oWujjutE؅UE E;E r3}jWG;0VuW;VuW\;VujWG;VuVWs;3E E0FvPFPWuA7E E0FvPFPWu9uuVu辿 UQQSVd@0pEPuuu u<|@EPjj[=؅| uuuu ujgu臨ujVE^[Uuuuuu um]U,SVuEWPj3jj]]]]]E]]]]]E]=|EuEPjj+=;,?*Vt$ w/r*D$f8 t f|p thwPH6+YY@^2USVu3WF;PE9]dVv p ;ÉE|cN ;t\F0;tF0F4;tF4V8;t1;ӉF8t'9v#B@xtx8t8C@;r3ۋF<;tȉNU8SVuW3FN;t V;U ;E}̉}ԉ}Љ}؉}Et5FEF;t(EEPEPESP}U;}_^[ }̃M9}EtME ;t0EEPEPESP};}}tu虡몉}E};t4uMWWQu0ut[;}}tu^9}tu붃}^tp3unG9}ttjF,WjPWWWSu6ۃ=E ujWF,jPWWWS;u6踃E 9} }&9}tjWWWEWPuZE F듋E;tMEFF+F 3u諠UE VuWxF(~$;v<;~,s) jM +ȍEhPE jPjMx}3_^]EF(F$~$D$ T$J$$+9L$uJ$ USVu3;u@ShEjPSEhPu]讶;|sjSEjPSuSESPV]u胂;|EjEhPESPVEw;|8] t/EShP;}uVEu|3^[EME@EX$EMH(EMH,EU$SVuW3WWVF3;WMjQWP}R;|E;tM QMjQPvD;zv~豾vߞWjvs;|WEjPWv.R;|]܍EhPEP}vD6薞VjD_^[U,E SVu3WF F$;tH3э~`ʃF$`dM9H E]PQV;|S9]toESPvh9wSSSjSu;|#SSju;;}"Wuuu؝_^[ SuD9^tEFEFDv腽SEjPS]uQ;|E;tM QMjQPuxSju;|SEjPSuP;|}ԍEhPEP]u^DE tQVP;>E tV;(E tVN;E VP(} UQVEWPjj=u.u}WtEPuV| w03_^Ujh@whۀwdPd%QQSVW?utju؉]ЅuMd _^[FE-eFP+FHFd+FHCF\CF`C iPuC}܅uEMwEԅ|MY4뎃eF`E̋FdE؋EM̅t΃mE؋E'HOfHfOfH fO H Q PG Ph@ nj}뮋u]ЀfEUE VWj@x8^VPu _^]MSu Q f@PfjfP T2t^(i^ XM } w܋I(P+[P 3Objects>%4uObjects=%4uVirtualAllocUjhPwhۀwdPd%QQ`SVWj}W؉]t;_8Wh!wEG [5w~<t2j@WquMd _^[0N Hf@e;sG@t ;F~G8tt @ QuE؅ F$tMȅtpFF eXACACEȀ̀fKhhwS< E@@E E}a]EO8Qwt$t$t$r j?t$t$t$\ UwVWu%d@0hjprw=wuHPHTwHTHPw3=w@s[u3󫍅POYYPVVV wwtpwtM fw_^ole32.dllUeVEhwPayuEVPjj߿}P: u EPCkEPEjP62}P E^StgConvertVariantToPropertyUjhpwhۀwdPd%QQSVWeehwEPEEu uuuuu uЉE܃ME܋Md _^[}tu$StgConvertPropertyToVariantUjhwhۀwdPd%QQSVWeehwEPEuuu uЈE܃ME܋Md _^[}tuÐStgPropertyLengthAsVariantUjhwhۀwdPd%QQSVWeehFwEPEuuu uЉE؃ME؋Md _^[}tuËD$EjXËe苵M3dtTE Dž@Dž@Pdt3jR3чUXE PuhP݇u E fEMdH038At/EEE@E@EEEEPEN3ÍEPgUfEUfEE WE3UEPEIPfM[_ |$XjW',Zd@0@,33+̋L$$QS膳 t [YjQ+ [YjQS=e$D$\$D$TPUPD$ d$D$D$D$TP$]3=WS}>f u -3&M,>EEjXËeME>USVWd@0@ t=xX;t3wwtN@P9Mr9Er?׋E 03_^[]E ˃ǹ#f=tf= u 3Efu})hf;}4hhMNMMMujujMQPEgM_dtfgf=BwuhBwj.EgfBw鑚f%=u eEgdpgdl덍EPj E|E_gEPj E}EHgE;E9gEE ,gfMgEg3EȋMċvuu飣ELEEjXËeEE0U@SVW39}}u*}E8EPjju8;u_^[EE~ F^]Љ}EE}E SV0Ǣ@yC #ΉM#ExP@ U})}^E RVpYU@B\ .##ÉMExX@ ]EM@E}E SVp@tbK%EUEԋEE;UU܉U؉PUԉPUP I`H]E9}]l}ȋUE9}U]Ћ}E9}]RMEE V Mܻt 2Ed{2Ë w3VWv5Dw֋:;|$ t@;r3_^DVS_VERSION_INFOLDR: Warning: invalid version resource LDR: Exception encountered processing bogus version resource UjhwhۀwdPd%QQSVWe3ɋuNEjXEU UԉMURPQjEPu~E܃MEEPEPuuy7E܃ME}\r~h(wE؃PdYYug}؋G0j YcȋڋG4 ډ^MMd _^[ jXËeMu\jXËeMumhHw~YM2jXËehpwUf=@wuh@w5|\EPf@wPu tEf=BwuhBw(|-EPfBwPu_tE;EuE;Eu2U=DwuYd@0hjpړtuDwHw DwwEѡwDwM Lw:w;Hwrd Hw@0 ̀Q5Dwjpwu2]HwDwmui\.mui\mui\fallback\.muid@0إuyud@0Au3;vd@0ǥ"uu ;V)YF;ƉE vfx\Ht;+ƍxȋʃM f9@wMfExuh@w3;S@w3E }M  7fFGGm yލ`fDu\ExPEPf\uf]fEEhwP EPEPuEPhf]EEPEPfEzEh*wPph0EȍEPf]fEkEPEP~Eh6wPEPEPzuEPnEhVwP`] EPESPE tŸ9E}f;fEEEESESESjEjSESPEPEhPEE@]]oKd@0WSpc;}!4t 9] uE E } RuEhjSShP;|huO~jSEjPEPSESPju]܉]]]`u~;|)u~;tuVutupuj$judEPu;|ۋUxB$J,r(+ȋʃMI0/0x]Vuud;v Dw Q;UtN;w;ud@0C2N Dww4w*w ww wwwwwwwwwQQSUVt$Wf~ D$0T$$;‰D$0sЋD$(T$tL$,F T$ T$( Qw$-%w ~D$ fWfarfzj|$ ҊWQ~fWfaT$,rfzk|$ ҊWQ~fWfaT$,rfzi|$ ҊWQ~fWfaT$,rfzg|$ ҊWQ~fWfaT$,rfze|$ ҊWQ~fWfaT$,rfzc|$ ҊWQ~fWfaT$,rfza|$ ҊWQ~fWfaT$,rfz_|$ ҊWQ~fWfaT$,rfz]|$ ҊWQ~fWfaT$,rfz[|$ ҊWQ~fWfaT$,rfzY|$ ҊWQ~fWfaT$,rfzW|$ ҊWQ~fWfaT$,rfzU|$ ҊWQ~fWfaT$,rfzS|$ ҊWQ~fWfaT$,rfzQ|$ ҊWQ~fWfaT$,rfzO|$ ҊWT$()T$jZT$(|D$0_9D$ ^][%YY-@wl]߃@w,kf-dwf|]t FF;r_^][\u@Fj;Xv<:\u@B;rUS] VW}f fUf=uuG8\ujXf;v K9\;urUuswi;u}>Ѐ\#ЋCȈE\#Ȁ=wtq<>\u1ev"E38=dwf9GC]9urQ] 9ut\}\u4ev%[E=dw3f9GC]] 9ur9ut\:s3_^[}vjXE9EvK3Ҁ<\‹@@͐RXACTLogUSV3WESPE ]GEhL)wPGEԋ}EEPSSESPEhPE}E]]>;d@0jSpmuu;Éu聨uz[UWPl{j_9}uTuE}PEuSPuV;}-u;u4[d6@0Spq_^[ @EPEPEPEPu|;ÉE}!uZd6@0SpqE벃} t#uZd6@0SpwqX9}tuZd֍EhX)wP0FEP(hPESPu;8] EPSSEWPug=#du@0Spl;EPEuWjPu';ÉE}d@0WSppdGljA X6z;ÉE}d@0WSpwpdEPuUx 6yh^3Wyyy U;ƉErdu@0jpku C pPV ds @0jpoEMs FEEPW]Tyt$y| t$!y} zE2zFt}tE2u膥zEPFPju*z}=4zzɸ zEEEEE3EEEE@Phut4T$Wzt"fBftV3^f"_a9EM 9jXËeM2 P+ȋ; G;| xM,H$M(H M$HM HMHMHt 5#[UQeE}SVW}EvT] E])Ep@ A$;ME wA)EE~03WQ؍} EE;ErEM8E 3_^[#xejqexPNFMNNNEPhEjP-lOVPD$L$P;Qu ;ujX3T$vL$ D$WV+4 Ju^_ X2.v .VU.M2.jXËe{I {I{UEU 8t X] e ?u u P XD$?u"T$ хuL$f#A D$ fA3 XyXu3xuX2y(T$ ` fHtP |$fH L$9tXAT$$,@t.fAt ĀA tu3T$ AL$$ , @3X~y~X;\X>Py4PX6D$#D$U$S39] VWuEZ28]uuzEEd@0xEPSSju}肦;É}=#u6uSWX;EPuWjuO;É}8WSuH]8]turFwEPjj;É`p7u eWStu]8]tu,F_^[u\EPSSju˥;É} =#{uSuW;u ^EPuWju若8]tuE9}WSuw\9]v%GEE0u :u[EEE;rWSu<\jXE܉EEEPEPUu]&;}]8]Z:EDtWSu[US]Vt\ef{svNW>w5Fu/u ~W薅t6<t2<t.<t*<t&E @ !FEC9Er_^[]E @ ݋EEmp VMME u D EEPVDtWvtJNtNtNuEE @\ EEu?uE @e EEEF<<<<V E#3ۋM,rHtHtHEEEN ʃM IDE@M,9M4Q+;vyˋȃbH2P rL M+ȅ҉Mt|tsp}8}(j3YM88Uu3M<@t8mM}ċуʃeMĉM}w9VtNM}wG+E;}`}ȃEHEMu HE0f@,F9UEtwO+M;wj }ȃE8w@uu VP诀Et(t#tttN !HEiN EGljEM,ۉ#X EM ;rE8]]unj]HX]4UVRu,u(u$u u4uHPu0QM=#MuE3;%8]tW;tSfFfE4EPVu=}9]Ht jEHXE4j]HX8]t8]4uu wED"9],8]8]}E3`9]d8]@[8]REPV`E;u FƉE+EPFuP:fE4 f)F] 8]E<#X E}-6SuTEfKe}E[}F$G}G G}EEu(HuSEfK@9EwE)EgE3KE4RMȋE,# UE(SVWj3_]W]0]E}u, M0E#trE;t@;rMu,MQuuuujjWu Pd;uE3;]EM;8]E(3E t8E;t";rMu,MQuuuujS8]$uwEM$;ÈM;rMu,MQuuuujSju P;uE3;|KEf9Xu]E;=9MwMu,MQSSSSSSSu Pj;uE3; _^[,=v}M(8]tڋE,f fHM:uU SVWd@0u(3ۋ@EE]uSuM;ÉtMu,PEPu$u uuuuu u;}.6SuQ#u E}r_^[(9]u6SuQU$eeSVW3}}}d@0u V@Et#fFN؁f;߉]tJ;uD}9}uCy}t uju Q}t ujuPEM_^[ΉM븋Vf;>;+}E e f9} tf;-N ;3'M% ɉE  fAĀA t tM fF؃ftĀN3EEj^@ E#΅M@ #֋EX#ދE@#ƉEDPwPuJ}\ MU<~ 3 عf#f+fCf f fC}3f9M;3f9MF;3f9M tf9MF ;t ]fCt ĀC tud3]S]SuRWuuQP؅EEȃ  M 0i<x~pN % } E <~йf#f+fBfffB}%ftNus3ҋNfttft ftgFu\3}fGt ĀGtuL3}W}WuRQuuVP؅EE% ]늋V뢋v%} E73^3k3xjWM G̀f OuNыʋU+ÉJ fMf JuNً˃+EJuN ˃uE+ʅJt N ˃+B3jg UmbUQeVu W}r(:w$r:wuuVWEE_^r:vr:vuuVWU8ESVu Ww:w38wtHV2xFWPE FЀ$ Ȁu[9]u9]tQEjPEP]]]]]E4 Eȉ]PWt+t Ou9]tuu u2_^[9]tuU@SVuW} w:wwtFO2GW ؉Eˉ]#ʃeGE V^ ‰UE#Ãe}V} u3;t4] tStO;uI] [;Zu>] [;Zu3] [ ;Z u(3;tN;tF;uQ;PuQ;PuI ;H t02_^[U [e Ry3r;u;uЋEMAMD PEAD P3G$р Ȁu9]u9]tEjPEP]]]]]EPFMQȃ]ȍHD PAFȃHt v+t:N!9]GuȃHD P9]GuUeeeeeSV3WuuuEd@0j_@WEEPTPsEWPEP\_E$9u}}(0t u>tu >w;|KGtEE$;tPVuRHE$0E @PwPu\CM$;Ɖ9ut uVuH9ut uVuG9ut uVuG_^[$EPEPEPEuju PTPEPTPVjuVVu؁ ;tE @@PwPuB;ƉEE uf9pX]Ep<<Cu EEPq<<<<E U@ #ЊCȃу ~VV|V zVVCE؋E @9EK3Euf9pX]Ju <<CVEԍEPBp)<!<<< F U #3U;CЃ UUỦUډUE e}fxv_EpuuWu7t.F#؋F!EF!E̋E!E!FE!FGEE @9E| ] ]]EC؋E]@9E}(3M eeEI;Ήuu~DUUЋZ Z wuEu]XE9MU|ōEPEPEPuju uuuuVjuVVu;{E@EPwPu?M$;ƉE U#P jff{&f }ffu }(U#V uuủu#3ۉu'PUwu8Uuu}uUO3VuU :wQNMQPt} O33"E$eEEE fxEHMA A EEHʃcHًM$ fAM#HNH!Mt4r,xtu E}PlEEt ~!E}ucEM FEE@EE M@9EIEHpȋE$MfIfH}(3Eau Nȃ34E(HNjKЀ}ҍw#щUЀ$#e#UE GH<wL<tHFtBjjSVut3FFt!MFt!MFu!E E E EtFEGH9E|UQQESVWj^uE E 3eMx@fI}vuItfOHud w@0ށSQpH<}u=_^[} tufW f;v+뙋ʋ+эt늋EjS7EeufxuvItZ} t<tPNȋE@؋EE@EE@9Er}MfIfHu렄]F NuK N ʃMIH ʃ@f\MfIȋE fHf@2F P谇D0 a]E ;tPSu?E E;tPSut?EE;tPSu\?EE;tPSuD?Eu;t PSu,?}uuS(hlt";u3voE;tFFt;u3;ÉEEqZC;u] f\;FFc;u] ZPŀtG ;id \ĀtF ;\Wv OEċ}%Ef MEt O Ātue% E  EωMĀtOxrWj3 2EtMfGȀ At0t OĀtue#E  E}MEMEs}s UkEk} tWjXEEEEePEUPu Yw}(acE} u |IEPuuu u'}EPEPuuuEԉEUr#3ut5Nȃ}u u$S(E+]H E` u$SE`E[Tduԋ@03Wp;D9}zuWS;kUxeeeeeSVW]d@0@EE3fqf#f;uJE}t uju$;}t uju;}t uju:E_^[ }fGЀ BE$@,@@EE f_Gt^uX!EEE}$t^EPEj8Pj u$vE=}u#}}E%eeljE뤍EPuuu$au)EZf}Ak3ɅɉMtutE [f_GttljEE3;PE EUfWtf4G;!3ۋEfHtpŀt 3EPEPju ##uuRSQV*EEEE$E%f E}gj EPwPu)4uEPjjͶE|'EPuVjuƁu؉E!}Vju8sIEfXtHu 3E@_fGt Oft:;u4u$f%f-ffM@MωM$ȍEPEP6uu$dVjuE7}ẺE$%EfHtfZH;Eu$E EVfWtf5G #3EfHtp ft 3URUR(j#u  ؋u#u SWPVEEuЋȃ  E MEj_@ E#@Mȍ #Dž^#ߋU$]R#UÍDPwPu1؅E=ȉM$@ fGt ft;O u/3f% f-  Mf@M4΋w ɋEfHtp fu33 3jSMEC@E fEf CfCfyt I LjKfC!s EuEf@f%0 f C}$cEuEf@f% f CuF E ыʃE+ˀ}KuM If Ku+N ʃ}CuE@f Cu6ju4e}N} u ȃu E +EK E u$} u Nu ȃ|E +EKE E[T$L$"rD$;s +;D$ rt2UQQVW} ru>uFt FuEt92_^ M Qj WPtF8u݊@<w9E rNjFEuF$,@t4Ft-MQjWP8tFH9MrP)rF$,@tUS38wVW} tW)=v_^[] @@u8]HftPfFw;ÉFuf;NrPE wPPv\;}8]t vw^늋FM 3zWi_UU=wSVW} t#WVH3;uEffXX3_^[] @@=vu}ftPfFw;ÉFuf;FvPE wPPv؅|WVypuby}t vwfaWEffXXPfFw;ÉFb}t vwffFPwFȡ@wكPPыMfPfE U}SVuW} ft!fFPwFu_^[] f;FvMEt(GUfPf=AE s]VE9MfZrff3f=Zw ȡwكPPыMfPfE UEQpEPWE@]UEQpEPrE]ƋAAƋt$ fAxƋAAƋt$ fAx΋ًXXf X\$fLff BBCCf;0fzw ҃ ʋًXXf XfًXXf Xfk#+ffGGf;UMuEf #r# 2f9;2{ #H*ErpEjpEbpEZpERpEJpEBpE:pE3-4=dwf.tZBFF;rf}rBMQPE PEjP[f}=u'EEE fEfEEPEP=ku"^ fMuEPu|3D$ f b=wu] 3D$SVWf8ft9t$^;~ #_^[PD$pFP9 f>3݋T$W3 zʃ_D$jQpEC@wTDeEUME]\sEeeU3VD;EvډMՃM EEE}E M ;}} C} u/()w8:wD;r+ƒ0;UE ()w8:w;rE+0;U낃e~M E9}r7E ()w8:wEË];rB+E܉E;EvC]uEEE9Es C]몋EeЈM E}EU(S]VW My}tC(w T8D8u;reuM ƃeE}Ɖ}{u"@wG }] 2EE Ћ##()w8:w;rE+Í;]pw;EE] 9EGE 롋}܋u]Xssu3!E!EJAD0;ljEv߉}ڃeEEEE] uE;u]G8U] u0#()w#8:wD0;rE+ƃ4;uv3E#()wE #8:w;rE+ƍ4;uy_^[ eq؍<e]9ur>E] ##()w8:wEË];rG+E؉E;Evf]E :uEC;]]sEEE 띃eEE}wY(w3"E :tFE9E1UVuu uGt u Vu^] ;#!;rދ3 Kuj _;#! ;#Í^ ;r΃ Nuj _;# UESVWqutH@wT1L1xEM 3ۅ]v Q"Hu3!E!EGۈ] }8:wtcU;Ur 9DsU;UsBU}t#t|9Fs^J^^}란}D EDu E;EF] ()wUHw++U8:w(w  ڀ] UщUU;Urupw9VӃepw(wӈUt eE]uU;UsBEU}tt|9~s^J^^u| }}|uU;Usc] ]] RuE9u]vO;]r 9DsD;]sC]}st'T|9BszN:zz_^[D EDEUQQjEjPuE u ME 3D$VWJtPt @w@3v@wIu_^D$VWJtPt (w @3v@ҁwIu_^UUM SVW} ;whtdHًO;։EuU@w")w"_^[] A@wuB;s Au@E)w2ΊAЄ@wu$B;s Au@E ъ)w 2 UQEɉMuEM 3 WIVpE S؍<;t3ȃM w u+E ;s:u  C;]sË<t;׋t3˃M w# Mu+E ;s:u  @;EsЋtM+É[^_/UM9uEM 3] E WVqȋS w u+H;v:u  Httȋw#] u+O;v:u  Ot׋tUO[+^ _JT$3S VD$ tK3f ΋t)3 t8Ȋ*()wP03 t(ճ ы3f ΋t t뵳뱁3 t롋 u ^[2됋D$3ҋS ʋT$ VtI3 ΋t% t28:wT3 t׳Ӌ3Ɂ ΋t3 t 볳(믁3 t0럋 u ^[8뎐 *** Assertion failed: %s%s *** Source File: %s, line %ld Break, Ignore, Terminate Process or Terminate Thread (bipt)? Execute '!cxr %p' to dump context U0VPe}EuNwuu uPhRwkEjPhwqEI!tWBu0Ph҈w7YYrp롃Pt&Ttbt׃it$pttuVjfvVj6:i^<%d:%d> Wait %x created by thread:<%x:%x> Nd@0VWpLNddq p$Vjv(hwBN;d<%d:%d> Wait %x deregistering by thread:<%x:%x> Wait %x deregister waiting ThreadId<%x:%x> Wait %x deregister completed ܈E1ˆdp WVv v(h0w@jjV蟈z33}tutWbxwt"ddq p$Vhdw>us+xwt VhwYYS蓞|3׊b4wڊb4w;ӊ2s [QVIPk^Vb4wXU=wVWt (|0=wu=PwV= wu}V_^ Vw(wjEE EEjPEPu莱Ɛ<%d:%d> TimerQueue %x created by thread:<%x:%x> wHZddq p$VSv8hw{(jt$ <%d:%d> Queue Delete(Queue:%x Event:%x by Thread:<%x:%x>) <%x> Queue delete waiting Thread<%d:%d> <%x> Queue delete completed USVu3ۅWu _^[]Nd@$F@xwt+ddq p$u Vv v8h8w|} u諛؅u 뚅tCCwF4WNW"jjVhw5wq}S袛SE 뻅tbxwt"ddq p$Vhxw5wsӚxwt VhwYYS;|3 <%d:%d:%d> Timer: created by Thread:<%x:%x> +ddr p$FQv8p8hwD<%d:%d:%d> Timer: updated by Thread:<%x:%x> b3+ddq p$Fv v8p8hbw  <%d:%d:%d> Timer: Cancel:(Timer:%x, Event:%x) <%d> Timer: %x: Cancel waiting Thread<%d:%d> <%d> Timer: %x: Cancel waiting done uFVv v8p8hޏw韆u肙ddq p$VuhwVuhBw 順 閆Vu jhw5w鑕|wHt8wHd@0Vjp `jXËeMu ww;t!yt ;u;t!lwJ @U=$wN w@Blw_U(wH] wHI= wC<=$wSLPwW$w;wu w8w+s;s1 @w+;vtwWwk̓ȸwE5=wwyME9=wu EPWIp=wCjXËeM3;I_sk鉆3.M_^[2e95(wu}qe2UjhwhۀwdPd%QQSVWewwEw w wM weQЃME`(wH wHMd _^[ jXËejXËe鄆U V3WVu EuPuVVVVVjM;uME9uu EPVn_^t$j\wf=ww~ME9=wu EPWyn=wRHMeMd _^[E0MуeEEPWnjXËeMMCalling WaitOrTimer: fn:%x context:%x bool:%d Thread<%d:%d> Calling WaitOrTimer:Timer: fn:%x context:%x bool:%d Thread<%d:%d> ddq p$GPv vh2wjnddq p$jv$v hrw+VgCalling WaitOrTimer(wait): fn:%x context:%x bool:%d Thread<%d:%d> QvMv(QP0VPSu}ddq p$jv vh"wd@0WjpY]MHVed}MHVGdAN$@#顄}|| F uMH9] t Su ~D3|V*U|%|Vc3b|%|@A龄<%d> Wait %x deleted in thread:%d dp$Vv(hwcjPCc @΄V7P7~Calling WaitOrTimer(Timer): fn:%x context:%x bool:%d Thread<%d:%d> ddq p$jv$v h(w d@0Wjp~tEMH]MH@W;@W6BF9?u.EPSVhwtju5w}v6uEPSVhw2ׄju5wR}„<%d> Timer: %x: deleted Vw8hjw W@_AS}Before service timer ThreadId<%x:%x> After service timer:ThreadId<%x:%x> ddq p$hw [A鄵j5w P5wm|VhM4ddq p$hڙw' & {w銄=|wwME9=wu EPWVh=w΄ĄUQSVW2uN 96tQ5w VEPWVhwtju5w{{~^;tNj?jPN~^;tNj?jP6F EMHuV*3_^[<%d> Queue: %x: deleted UxwVutVv8hw wHF4tjP?d@0Vjp<^]Thread died before event could be signalledSSShwu ;|EPSuah w3YY\d@0WSpV 3郍vd@0Vjp鬍ME=hwmEPjMf<%1d> Queue: %x FiringTime:%d Timer: %x Delta:%d Period:%d Vt$WvVt$hޜwa~7;t!S\$^v(SVhw>6;u[_^ ===========RtlTimerThread not yet initialized========== ================Printing timerqueues==================== TimeRemaining: %d ================Printed ================================ UQSVW35w]x dp$=wthnw/Y_^[;5wuBhwYWhw 5wYYw;t~EuWVq6hwSSSh4w5w뜐Using obsolete function call: RtlSetTimer Using obsolete function call: RtlSetTimer UPwPwuhԞwVYZhwFYu uuuuu u3]MEPjEigcd鰉Using obsolete function call: RtlCancelTimer Using obsolete function call: RtlCancelTimer TwTwuhwYYhȟw~Yjt$ t$ vU EPEPjj>Mt f=#UM t f=#EU} S]VuWjE PE PEjPj|bfDEj%FHYNhFTEÀ~DFXuVE MFLE؉^PFXVFdEF8EFfVf9F uWXPF P(;tjXËefVpuG EPLP?ut3M!FfFjXËe3UVu W}G>@sjPPy;ljEw f3_^e3v%u 8;Ms M@;E rMUUnexpected exception in RtlWalkFrameChain ... UjhwhۀwdPd%QQ SVWem̋M̋dp3ۉ]];] sMA;sFUЋE;s8;s4;s;r,=r%ʉM̋UCjXËehwY#UMEMd _^[ =; +O0HuEEjXËeMEEeEYt5J5B5j_jY0j_jj_j 5jzjz_;V8]EE]E@E]]tSSSESPWuѼEPhuRtlpQueryRegistryDirect: truncating SZ Value length: %x -> %x UUSVWtVtQtLMwu }ȃ3Z}} ;s#Dq;ru ‹u;w)u]{u]PwCu#_^[]PVhʫwEu fs{΋u ȋEf[f;svcRTL: Expand variables for %wZ failed - Status == %lx Size %x > %x <%x> RTL: Expand variables for %wZ failed - Status == %lx RtlpCallQueryRegistryRoutine: skipping expansion. Status=%x RequiredLength=%x RtlpCallQueryRegistryRoutine: skipping environment expansion. ValueLength=%x U US] V"EE4CW]uK }u ;GG t-CK$y+;} }#+:_^[CDыэsEʃK}f$M DM$+ȉEMCsE C EG} M3ލL1;MsfCCfu+G w PVjG =#u3K;]r?GEy}GuG$%4OwЋGMU EQt.jY;t':f>tffuf9u+f>Ft f@@fu+w uPVju<} Etk=`2Ʌtf:%BBHHutVEMfEfEE3҉u;ʉEfUdfUEPEPEPu4EE |eEu@@EG w uVu p=#3tw fMfTHfEfy#;uEU‹U+É9Mu_EPEu0EQPhwE=t =#Xf}t }CuPhnwP +uEPh6w7 몃}  =PhwYYuuVu uUQV339u utEhPE Pj 9utjhuEVPjë;}uM;tE^RtlQueryRegistryValues: Miscomputed buffer size at line %d RtlQueryRegistryValues: Miscomputed buffer size at line %d UʃLt jX+ȉL<E;,++Hh PD;PjM| 艝Dz1tjuVfC PufC E M+ȉMhEPEPjWE}Sd@0@ @ <@,PhwYYuuuhwj՘\E)CQhǍPFPiN:hhǍPFPiN t vhCPؐ;d@0@ @ ,PhDw1YYDPShPw ShǍPFPiNEWVu[>e5Āa E SjXËe]Ԁc@ E '3HE DžPXDž`TE䉅dPPD鷾E3=Ëed d1F4e_uuuPQ}dE̹ duQ^F4魍EEjXËedEč EЉdu1F4ejIuuPQw~JxEIdEй duQF4IExIUjhȆwhۀwdPd%QQ$SVWeMM؀eeE Ait(u!uuuPQ*Md _^[euxEEEHMQu:dEй duQF4eMcE놋E"ˆAU ЈQEЋEEjXËedEȍ Eԉdu1yF4e됀}tExÐGlobalTags39=wu%dhj@0p;w;};teFtjEPYYfEit)Eu#uuu V蘂E؃MQE E E uxE}}]f;!u0CEfCC]fuÉEf8tf@@EfuEe݃}uuuԅj_}F E9EtWuЍFP, @uF E}tyuYEȅtisd+ȉM܉]f;tZ~}}tuŴYYEȍN<;t7EM;tPQPQ8]tXX댹ft3Ef=vt;h@EM;tPQPQ8]tXXEw)38]tEx!UjhwhۀwdPd%QQHSVW}}3ۈ]Gt uuu WeMd _^[SjEPSuVj^pE;|Ձ}u 9utu)uȉ]E uxKEEE@]E؀}@s1EMDXE;M;;H$E 9]EMM9uu>EȉEESjMQSPjoE}};|} uE}E M}ȉ};ra9}w\M9MuujVEPSEPjӖEE9]|"WMQPSuPutEMEE#38]tExKÀ}@u MM]EPV{EEjXËedEȍ Ẻdu1F4uu W_!jV<EEjXËedEȍ Ẻdu1]F4eeuuU SEVWPVEz3;v6EjEhPESPj]F;}2_^[uV>3;vESS4u]F;r獅9EtEhPEPjEu u]r]}UjhwhۀwdPd%QQSVWdp0ehw:e3};su 4UE|G܃MEMd _^[hwUjhwhۀwdPd%QQ\SVW}׉UeM OM it#uuQW}Md _^[ u>@t3FFF F^ ]ЋC@jh PjSj菓E39ECC CM U OM euxEM Ue}@svEDXEԅtYx(ix ~@ F E˅ttC hPSjEjY3}dB tBF봋F FB(~+~PU܋E;tEȋx~x~e;yFME ~}7S u~}7S u E}@EMLXMԅE9Atى];Y$kCtASU;C+}EM;AtlH;uO9xuHME M!MCt];Y$ A0E9X;wM̉EẼ 뉃eEPuz EEMHExCt,S7}fMfA "tfGMfAEf` !uMEf`uu E|QuE8E E EMEEMԋufC둅uY$XXE]R}EPE܋8}e;}ȃeEPSq E|zEG MAGO+ȋEHfGMfA !u&Ef`EEUtI;JsEfG MfAՋ M?}Ef}CEM KM tPP;QuP;QuMPS1 EЅt-P;Qr%MEU29 M!u]럋M̉E M̃!닋uE8E EEu]ЋEEtuS. E}ă~u~tEME}tExu Sf;P4PVS9UʃtjX+ȍ49u0E++ƒ h PD7PT MU| UwSVW3;u;@wE@ 5wF}t&E9~<^%4uObjects=%4uVirtualAllocwL$fŀtjfD$ttvfuhhwhXw- XwfsPhwh6whXw-YYtf;H8s@t1} WVXG;C;fFf=E}ftf^fFe}]Esf;EWM̍yfEfFfEfFfEfF fEfF fefEEf}PEPfE4XEPEP襹Ef;+؃f]]jXf9EE~3fEEPEPWtEPEP^E]fEf;E|͍Ef]PEPW}MUfEf;E|E;H|;fEefEfFfEfFfEfF fEfF fefEEGPEPf}fE0Wu#2_^[}E}]+E H&2rD$`XwV5dXw3hQP@X^L$Q2/D$PwV5Tw3hQP X^L$QU0jEj0Pju|EPME UP3<9QuBprtrqt1;uPJ<019N~t~ދpqtprt1;uHPI<019N~t~މP<9Qu@rqtprt1;uPJk019N~t~prtpqt1;uPH;019N~t~ރ~;VVP@;3;H;9qQuʉ60V;SVt$ 3W|$9^t9^tVw96uVPF;u)9^u;u_^[9pHtH;uF;u9qQtQŋD$@t Ht3D$@t Ht3L$At Htȋ9HtB+#L$At Htȋ9HtB+#D$L$SV9Wt9uЋʋ;t~9r;td9tr9OWtW>:10qPpqQPpQPtPtAtAt_^[9tr뭋;t39JrtrqPpqQPpQ9@u H댉ډHUE3ҍHHH M HMHMH MPPH$]3 :Ej0:Et 3:s:Xi:]y:2:UE PEPu u]Vt$W|$ Vt$Wp9L$tu68_^3W|$W:t3_|$ Vt 7Ft7tV88ƃ#^ċ;v+:@Nu:ۍA:ӋJuu:ҍAj:@Ju_:3a:D$@W|$W9t3_Vt$u HtPtH^#̸ n>%%%u!%s!hchs<ډ]|xff;f=9<ډ]|xff;f=9 ΄UEwjZvcEGPWh$wu$VZpfXHfcu(fPfhtfwtflth8wQ\ZYYrfsuf@f=htf=wt f=lth@wfSu fs?fC5fc+8Et; C]U}T}t-C]U6 CI]􉌝ÃC@]􉄝 M$9}$kf ډ})U$9}$Nf f M$9}$4EtE$Euf EM$9}$uf )U$9}$f%ff9TADAE;E U3;ff= tf= uAA;u;U vEfPf tf u;E Ew}+u:M$}$~d+6PGQP< f GuGef twvʋU$DE$뾃m$9E$~f FFEEf FF5Vt$ jNfLfFNwFu ^L$QRQRQ RQ RQ RQ RQ RQRQRQR1hЌwP43UEVPEPEPEPEu PEPEPEPFPFPEVhЌwQp)8u ^3ɍET1A@@r3UQQUEESfV3W;Ήu }j[%ff;uff=0rf=9w tHf=luEf=Xtf=xu3UNtT} ff0rf9wɍDM farffw ɍDfAr[fFwUɍDσE}MIt$E3f;*9u t/f97t*f9u tf9u M ˃_^[Ë}̋EU} SVWEt_=wtVE]}{M3f97uv:Gf8.u1Eu uEPWf;tf=.uEEu V߀e먀e9EuMu cEujPWuf;teM;Ms]SsU}t0f==w3Lw}jYM}wu jfDKCEPWUfu}EuCwEWfE3Mf f;҃0fmK@fTsrрCC}jfC.Xu ECPEPWftgssP}t(f=v?=w3ȊTOt)}jYM}w"u fDsCj묋}jY}jYft CfDC~C { {} fC wf=3ҊTAj^fCf=3ҊTAjX ƉE WjfEX+E j^+u ;s*LC+Ef f;҃fm0fAANuܰC *E CCK E uv/j 3_B0f=9ftej 3YE NN} v͋E uE+Cuf~ ȋEsxʃfKufxM t2@t&-tQh|wt$kD$ 문hw른Pw랸8w뗸$w됸w뉐PAGEHEAP: Failed changing VM at %08X size 0x%X from %s to %s (Status %08X) U8SVE Wu} PEuu}PEPj^&3;| _^[}u=7##E;sjuVSu E;rEPMjQPVjE ,ESPurPEPuePWVh wrw2rL$APt9ATQPuaTIXD$L$PPxPuHT@XHPD$3ҋ@ tH;L$tЋL$ t 3D$L$V9H@uP@9HDt$upDtHHI)HL^ L$D$!P4uH0@8H4IH< D$L$V9H01up09H4T$uP4t2H8Q)P}t8SVgt-uSVuF<FL;rWVNuSVc_^[]L$D$!PduH`HdIHl@h S\$VWj(3Y|$ύPv q(J1ut$!VTu)~PFX|$NTtVbPVxX_^[:US]3V9CPWE-PE@PWS}{P uMVQPSE{Pue}S}uSEt2}jjuWuHu9!uEhPE}PjE_^[uVSF^EVu-օtM3ʃ}juWuuBuV/PVxXVMP+V9XP]SEhE9Fv F)FVuVuUQejEhPEjPj+N|E3UQQSVWuMEtu>Euuu2_^[E f;vWyu&s ScuuuHu륋EPupx EPupx뇋D$VHxup`tjjvv6^VW|$ xuw`tjjvv6Gx_^PAGEHEAP: Tail fill corruption detected: Allocation at 0x%08X Requested size 0x%08X Allocated size 0x%08X Corruption at 0x%08X D$VWpPx 2+;s9uA3Ʌt"QWRVhw(ph<w_^2UQE SVuW;UE @jPSVuE jPSVtGjjSPEu 3_^[9_vb_)_)^LVMXHMPVU)<9u WV1US]eVW}FE;E v tDsFuWSF49~ uWFuP;tYE eWS3;t.U uHHHx ύxPMÜA; v _^[]UU S]VWu3 vj XjPxPʐ3;ME s=x++΍;EMދσ+ˋ] E ME uME;v+_^[E2UPE PEPE jPCtMQPu uy3PAGEHEAP: ASSERTION FAILED: (SystemInfo.PageSize == PAGE_SIZE) PAGEHEAP: ASSERTION FAILED: (SystemInfo.AllocationGranularity == VM_UNIT_SIZE) PAGEHEAP: Insufficient memory to create heap PAGEHEAP: process 0x%X created debug heap %p (flags 0x%X, %u, %u, %u, %u) U4HwSVW}39E u}9EuxPMj,QPwF9ut hw;9}t hBw'PE؅u8W}؅u)E t hwEt hk3_^[jjh`SueEhP] E Pj轥뷹jEj VSC CaueEhP] E 붋EF@FHwHwt3Ɋ̨ Pw Lw3EWPEͫ6$EgjWuuWu{vN,WhNormalHeap) Percentage: %u (%08X, %08X) Normal allocation forced by percentage of availmem Random number %u Normal allocation due to random choice Normal allocation due to the verified range Verified allocation with minimize memory impact flag on PAGEHEAP: Invalid allocation size PAGEHEAP: Unable to allocate virtual memory U@SVWu.3;u 3_^[ C E 9u hw*Vh8Pj>A;}uu |9u'jd^;5PwwW8wt hwfY뾋3kdjd^+8wtVhwf롃=Lwu S{tS5PE{tSs08wtjd3YRh$w3fYYjd3Y;Lw8wt h8w fY};= w;=NormalHeap) PAGEHEAP: Normal heap free operation failed PAGEHEAP: Attempt to reference block which is not allocated USVWuu 2_^[] }uE GPWE GtWME2PuWPuttd9u h0wKuu 6|؄u hdwGtWwuE t hQhwj[t^F vjSPFPuVWVWF$tHv IHF$N)Ht.jWF$`F;FvV(F vjSPv똃f$9PAGEHEAP: Invalid allocation size PAGEHEAP: ASSERTION FAILED: (HeapRoot->NormalHeap) PAGEHEAP: Normal heap realloc operation failed PAGEHEAP: Attempt to reference block which is not allocated PAGEHEAP: ASSERTION FAILED: (NewNode != NULL) UjhhwhۀwdPd%QQ(SVWeuu3;u3Md _^[] ^] SVXFtV}u}vAt h. wFtV{v跈}uE t h@E끍EPuV؉];uIt6?u hR wuuu 7YE܅uh wwh wmuC;CvSuSV}}؋tEdžt džuu uE܋EبtM}܅K;MvMvuȃujuV8wtu h wCGE %uC G C v jjPsHSVC$tHv IHC$K)Ht&jVkC$MjXËeM]Ћu3c$.SV"PAGEHEAP: Attempt to destroy process heap PAGEHEAP: Unable to release virtual memory UQVWdH0E;Auh#wz_3^PLtF PVFtV,~ tG;GvW? wWFttzNpHpFptwNtHt wWvvQSvoF>EeEhPEPj3Ʌu h#wu/Fp@w낋FtwPAGEHEAP: ASSERTION FAILED: (HeapRoot->NormalHeap) PAGEHEAP: Normal heap size operation failed PAGEHEAP: Attempt to reference block which is not allocated VWt$ u_^ S\$ ^SV"FtVjt$Vuute9u h$wt$S7 qu h"%wpFtVvVut h[bhR%wċxĐPAGEHEAP: BUG: process heap list count wrong =wVW wu WwW諃 w;L$ wC@w3tL$@pFu w;t hP&wW蔃_^Vt$etF D$ PVvc3^PAGEHEAP: ASSERTION FAILED: (HeapRoot->NormalHeap) UQeSVWu3;u 2_^[ ] ^SVVFtV9}tpWuVE9}u2t)u h 'wuS7XE3FtVSv菂9}t 9}Erk}똸t$Gu2pPt$(u2p1PAGEHEAP: Attempt to reference block which is not allocated UQeVuu2^W} ~SWV!^tVjuVuDt/uuWE^tV7vsE[_hP(whڋMEHΐPAGEHEAP: Attempt to reference block which is not allocated UQeVuu2^W} ~SWVG^tVjuVuGt2uuuWI#E^tVZv薀E[_h*)wڋMtPMt@ EPAGEHEAP: Attempt to reference block which is not allocated UQeVuu2^W} ~SWVY^tVjuVuGt2uuuWE^tVlvE[_h*wڋME#H MH Vt$]u2^WjV~tV6f~tVv;_33SVWt$u _^[ \$j@Z9tj3YPVI~tVF\CFCFC FC~tVtv~3Vt$tvktv~2^f Vw鍸f ^w鎸f fw鏸HEAP[%wZ]: Heap %x - headers modified (%x is %x instead of %x) This is located in the %s field of the heap header. U=`wSVW}4w4u(G2EjEhPjVj0E G2} EPuv6WKe9]d@0@ @ ,Ph$,wwTY;Y4 0PWh0,w_T3Ƀ9 |wtw;Xr;r#Axu2_^[]W6] 4|whh,wTYYҰАHEAP[%wZ]: Invalid ReserveSize parameter - %lx HEAP[%wZ]: Invalid CommitSize parameter - %lx HEAP[%wZ]: May not specify Lock parameter with HEAP_NO_SERIALIZE HEAP[%wZ]: Specified HeapBase (%lx) invalid, Status = %lx HEAP[%wZ]: Specified HeapBase (%lx) != to BaseAddress (%lx) HEAP[%wZ]: Specified HeapBase (%lx) is free or not writable USVuWw.wQYYuVhJ.wQ W19ut*d@0@ @ ,Ph~.wqQYYuVh.wÁ}u2d@0@ @ ,Ph.w>QYYuh.w/QY;u`uuuVSa;tFt 9fjjVVBj8jVfthW8}WjVZk2f fjVxHEAP[%wZ]: May not destroy the process heap at %x RtlDestroyHeapUQVd@0u;pu3d@0@ @ ,Ph 1wPYYVh1wPYY2^h>1wVV tjVH tރf~4F4teMhQPj҉뺐RtlAllocateHeapHEAP[%wZ]: Invalid allocation size - %lx (exceeded %x) HEAP[%wZ]: Just allocated block at %lx for 0x%x bytes HEAP[%wZ]: Just allocated block at %lx for 0x%x bytes with tag %ws UjhЊwhۀwdPd%QQLSVWeuuЀe3}Ftuu V7Md _^[ }j[]h1wV u}܃eM)E‹F  E }uˋFH#FLE;q;F,h] uxv] ] jVzWu V=}SVGE@P~}Ft|6ff}F tjV}5E;Pwu\dE@0@ @ EE,Ph$2wMYYu5Pwh02wvM jG"f'fx냋}8ff;=TwfF0f;VwdE@0@ @ EE,Ph\2wLYYWV褠Puuhh2wLedE@0@ @ EĉEȃ,Ph1wLYYv,Wh1wL eEE3=ËedE Edu1 F4벀}tExuÐRtlReAllocateHeapHEAP[%wZ]: Invalid allocation size - %lx (exceeded %x) RtlReAllocateHeapHEAP[%wZ]: About to reallocate block at %lx to 0x%x bytes HEAP[%wZ]: About to rellocate block at %lx to 0x%x bytes with tag %ws HEAP[%wZ]: Just reallocated block at %lx to 0x%x bytes HEAP[%wZ]: Just reallocated block at %lx to 0x%x bytes with tag %ws UjhwhۀwdPd%QQdSVWeuuЀe3}Ft uuu V Md _^[}j[]hb5wVu}܃eMAE‹F  E }uˋFH#FLE;;F,yE uxrE ] jVJ]{}h5wWVH|;XwdE@0@ @ EE,Ph5wIYYu5Xwh5wI j_uSu VCE܅t5E@FP}F(1ffGfEjV7jV}E;XwdE@0@ @ EE,PhJ6wHYYu5XwhV6wH jo諵6=\w)Gt}W1Efx}f f;=\wfF0f;^wdE@0@ @ EE,Ph6wJHYYWVPuSh6w2Hff'f@}f;=\wfF0f;^wdE@0@ @ EE,Ph6wGYYWVePuuh6wGdE@0@ @ EĉEȃ,Phv5wsGYYv,Wh5wcG j4eEE3=ËedE Edu1zF4벀}tExoÐRtlFreeHeapRtlFreeHeapHEAP[%wZ]: About to free block at %lx HEAP[%wZ]: About to free block at %lx with tag %ws UjhwhۀwdPd%QQ@SVWeuuЀeeFtuu VlMd _^[ ej_}h:wVlF  E E uxnE } jV7]{}Eh:wWV,xtf;`wusdE@0@ @ EĉEȃ,Ph:wEYY5`wh:w}EYYjOSu V=EjVcjVeME %tă=dwtGtnWEfx}ftf;=dwufF0f;fwudE@0@ @ EE,Ph:wDYYWV肘PSh:wD @f똋EEjXËedE Edu12xF4e}tEx=mÐRtlGetUserInfoHeapRtlGetUserInfoHeapUjhwhۀwdPd%QQSVWeuu؀eeFt#uuuu VMd _^[eEhB=wVu EeMEF  E E ux9lEM jV}GEhV=wPVutuuWu VE딋EEjXËedEЍ Eԉdu1vF4U}tExkÐRtlSetUserValueHeapRtlSetUserValueHeapUjh0whۀwdPd%QQSVWeuu؀eeFt uuu VtMd _^[eEh>wVu EeMEF  E E uxjEM jVp}GEh>wPVnttuWu V)EjV?돋EEjXËedEЍ Eԉdu1cuF4P}tExrjRtlSetUserFlagsHeapRtlSetUserFlagsHeapUjhHwhۀwdPd%QQSVWeuu؀eeFt#uuuu VMd _^[EEeEh @wV7u EeME멋F  E E uxWiEM jV}GEh @wPVrtuuWu VEjV댋EEjXËedEЍ Eԉdu1sF4M2}tExhRtlSizeHeapRtlSizeHeapUjh`whۀwdPd%QQSVWeuu؀eFtuu VMd _^[ M3}EhAwVu}eME뻋F  E E uxgM EWV}GEhAwPVqtWu VTE뛋EEjXËedEЍ Eԉdu1rF4\}tExgRtlCompactHeapUjhxwhۀwdPd%QQSVWeuu܀eFtu VMd _^[3}}j[]hBwVu}}ME뾋F  E ] uxf] ] WV]u V'uESV벋EEjXËedEԍ E؉du1nqF4er}tExyfÐRtlZeroHeapUjhwhۀwdPd%QQSVWeuu؀eFtu VMd _^[eeEhDwVyt0F  E E uxeEM jVG uE eM)Eu VV~EEEjXËeE}tExzeRtlCreateTagHeapUjhwhۀwdPd%QQSVWeuueeej[]hEwVtFF  E ] uxd] ] jVh tuuu VMESVeMPE܋Md _^[EEjXËedEԍ E؉du1PoF4룀}tExbdRtlQueryTagHeapUjhwhۀwdPd%QQSVWeuu܀eeeEhFwVtEF  E E uxcEM jVM tuuuu V4}EeMPEMd _^[EEjXËedEԍ E؉du19nF4룀}tExKcÐRtlUsageHeapUjh؋whۀwdPd%QQSVWeuu܀eFtuu VMd _^[ eeEh4GwVGt0F  E E ux|bEM jV uE eM,Euu V[E݋EEjXËeE}tExEbÐRtlWalkHeapUjhwhۀwdPd%QQSVWeeeh:Hwutt jud EMEMd _^[EEjXËed E܉d1ulF4HEAP[%wZ]: Invalid Address specified to %s( %lx, %lx ) Ӂkd@0@ @ ,PhHwT8YCYPVuhHw@8S 2?kStjHEAP[%wZ]: Heap entry %lx is beyond uncommited range [%x .. %x) HEAP[%wZ]: Heap entry %lx has incorrect PreviousSize field (%04x instead of %04x) HEAP[%wZ]: Free Heap block %lx modified at %lx after it was freed HEAP[%wZ]: Heap block at %lx has incorrect segment index (%x) HEAP[%wZ]: Heap block at %lx is not last block in segment (%x) HEAP[%wZ]: Heap block at %lx does not match address of next uncommitted address (%x) HEAP[%wZ]: Heap Segment at %lx contains invalid NumberOfUnCommittedPages (%x != %x) HEAP[%wZ]: Heap Segment at %lx contains invalid NumberOfUnCommittedRanges (%x != %x) UeeSVuW} 9w_0t;w$Eۉ0t ;se;w$sߋE0fEf;FfȉEFM} t4tdVȷf@MftĀtT%f=sU$FtVc|ME8FF`fFuUf;B8sU 맋EEE@ @tFtM t vm hFu P;E Evd@0@ @ ,PhJwS4EYYD0PVh Jw>4 2_^[ u3;w$d@0@ @ ,PhJw4YYw$VhJw붋C;s ME>d@0@ @ ,Ph|Iw3CYYKQPVhIw3`d@0@ @ ,PhIw~3EYYPFPVhIwd@0@ @ ,PhXJwM3EYYPVhdJwd@0@ @ ,PhJw3YYsVhJw8E9G(t0d@0@ @ ,Ph4Kw2YYuw(Wh@Kw,E9G,t0d@0@ @ ,PhKw2YYuw,WhKw\HEAP[%wZ]: dedicated (%04x) free list empty but marked as non-empty HEAP[%wZ]: dedicated (%04x) free list non-empty but marked as empty HEAP[%wZ]: dedicated (%04x) free list element %lx is marked busy HEAP[%wZ]: Dedicated (%04x) free list element %lx is wrong size (%04x) HEAP[%wZ]: Non-Dedicated free list element %lx with too small size (%04x) HEAP[%wZ]: Non-Dedicated free list element %lx is out of order HEAP[%wZ]: Number of free blocks in arena (%ld) does not match number in the free lists (%ld) HEAP[%wZ]: Total size of free blocks in arena (%ld) does not match number total in heap header (%ld) HEAP[%wZ]: Pseudo Tag %04x size incorrect (%x != %x) %x HEAP[%wZ]: Tag %04x (%ws) size incorrect (%x != %x) %x USVW}3}VWuu} u G u荗xu9ut4M39j[E 8XEti} 3;puF4}t;]O}uf>o}u f9fE3h} ud@0@ @ ,PhPOw.YYuh\OwE}rG8= wEt0tt'jEhPEjPja | EEwP_P;t\Mt*fF ft!Āt7%f=sMNFtFP]u6uf;G8sʃeee E DXt uMuQMQMQu PWtDE } @rˋu};ut_d@0@ @ ,PhPww-YYVuhPwg- u7}teEhPEPjFg2_^[E9G(t,d@0@ @ ,PhQw-YYw(uh$Qw땋Etettj[˃ ;NuQCfrwUd@0xtEwwAw]UEHt'HE VU@Uu@IUu^EE] SVW|$GPt$jt$y.t=PXu_^[fHXf@Zf;+f;+΋+@3t$t$j+j^ jXËe3MuFjXËeE@M*Uf}uE E3] f}u E ޸UE MSVuW<Mf}MuqE ^w;ljEs7u$EPuVWuu |AtU=uNEu9}rɋE;w&f+uE ۉ0_^[] f}u E _w2밸UQQE US]VEEWEEBEE%;EEEM QPRuSM] U;]E;EBEf}} z+M 4;us|3ˋރQffEE;EM vM+ˉM D;Ew8rȃFffEkMU _^[;Uv EB+]E3UE MUEESVW<}t`EBEE]#u;rX;ЍG+;w6t(EBEf}tEu#ffEffEڋE 3MM;ljEFM+;M rM EMuy;MutEPuRuuKME3)M EUO; MJMf}Eu%\u EPuRPVAK|[M+;ErWM}ȃ}\D;wVtf fMwMU_^[MU}+ˋȃE+EE+EMEBUeS] 2VWM;EsEUu;ƉEru} EeeGXwrGE uuF;E]FE E wM ;s \w@O wM ;rEK3;MwWSU;usHM EEFE CE]@Eu;]sEMeuFE ;]oMU;]d;EKu }Eff-f%03Ɉ̈J3_^[M ;MsM+W M]u&Hf ]3ʈFE .FE /uHf ӃuJ?P f뾃uJP f멃uȁf돃uȁtuЀ?YuЀ>ȁ(f#};}s>EE+0ff-f%̰t"3ۈ܈ZfNfU SVuWU e ^3σe~3ji_|L}M? ;:MYr>;s:8u68Gu/F8Gu'9JM vύF+;Bs:u E @] ;ZrM; rB;s>8u8F8Au0F8Au(jX9BEvF+;Bs:u E@];ZrE9E rE8E0E z _^[M9M1MJ UQE eVuWx;s9Se v+;ps:2u E F9} rU ;UrUH uA;r[}_^#E3wtL$T$i8 $T$D$ ÍT$ !P<$f<$ti!T$J~!8SL$!u=w w$D$%v!=!f$f=[!f% N!f% A!,! ZÍT$ D$uWAD$ %=u T$u^uatQ$\$qE!Yat=w wZD$u3m3% D$KT$ ND$ % D$؋D$tAvl$D$t-wt_tf<$t,$Z% D$u3-wٱu wٛuÃ=w~ht$d!YYËD$ wfA%Ã=w~jt$9!YYËD$ wAÃ=w~jt$!YYËD$ wAjt$ YYÃ=w~ht$ YYËD$ wA%jt$ YYÃ=w~jt$ YYËD$ wAÃ=w~ht$u YYËD$ wfA%Ã=w~hWt$G YYËD$ wfA%WÃ=w~ht$ YYËD$ wfA%Ã=w~j t$YYËD$ wA Á|$ËD$Ã=w~ht$YYu|$_táwL$fH%jXÃ=w~ht$qYYu|$_táwL$fH%jXGT$ڃD$T$؋L$T$D$ ud$ȋD$r;T$wr;D$vN3ҋSW3D$ }GT$ ڃD$T$ D$ }T$ڃD$T$ uL$D$3D$ 3OyQ_[؋L$T$D$ ud$d$r;T$wr;D$ v+D$T$+D$ T$Oy؃릀@s sË333À@s sËjPYYzGX7GjVYYESUVW|$=w~jPYYtG wA7G-t$t+u7G33=w~-jVbYYt,jj USȍF7GʡwpЃ|$-u؋Ճ_^][Ëȋ\$T$D$ ud$ȋD$r;T$wr;D$ vN3ҋ[ȋ\$T$ D$ ud$d$r;T$ wr;D$v+D$T$+D$T$ ؃.3Ҁ33jj u-ArU3} u9E}jXPuu ugrE ]U3} u9E  |9EsjXPuuu uE]U}SVuWt-F}u3PWu ua3PWu u' EU v/WFwrwŀ&NMNA;ΉMr_^[]0Ujuuu urE]U(uEPu Ej(Pu E U(uEPu| Ej(Pu E UPuEPu uEjPPuE ËL$St@|$VD$ t$t F@:t(It:t^X:t u^3[È@^[UWVSM t?u} hwxu?AZ &FG:t:r:w:r:w:u Iuۋ[^_ùr33ۋFG:tQPSD؃:Y:uIu뿹rU EVEEE EBEEPEuPK Mx E ^ÍEPjYYEPjYY\EPjYY\UQeS]VW3I{:u tjSV>: fCCe ˄Mt"_^[ËE 4 ,AE GEt {}t+;sVSW.9 $>Et 뢸3ۋ ޅFG:tPS+؃!:t鲅33ۋ t# tFGQPS؃Y;u Iu3;%u%n%D$ Ët$jVzYYŽD$ËEEM ÍEPjOYYD$f8tffAr fZw fAAf9uËD$f8tffar fzwfAAf9uUjEuPKH EP?YUPjPEuP(H EPYÍT$~R<$tf<$t-Xw=w wf$f=f% xf% kZ=wD wZéuՃ|$u-wrkUQQSVV5w&EY؋EYQf%Qf=$u_%YY~/~u%ESQQ$j ^[VS&EYYE%8wSQQ$EQQ$j j$U]YYt tVS9&EYYESQQ$EQQ$j j뺍T$R<$tmf<$t-Xwz=w  wt-Zwz=w w9ZéuՃ|$u-wUQQVWVh?j%Ef%Yf=YunEQQ$"$YHYtNHt;EHWt#%@wQQ$EQQ$jjq_^QQ$j VW%EYYVW$EYY͋E V%WEEE$EYYUQQSVV5w$EY؋EYQf%Qf=$u_l#YY~/~u%ESQQ$j s^[VSh$EYYE%HwSQQ$EQQ$j j"U]YYt tVS$EYYESQQ$EQQ$j jht$YYjt$YYht$YY3ËD$}ÍT$R<$tCD$ f<$t-Xwtru8=w w u:|$u3%t-w=wc wZکu|$u-w3Lw*} 3ID$ St~T$3ۊ\$ t B2thHtburFWߋߋ 3˿~3σtJ2t82t.2t!2ts_t B2tHu[_B[ÍB_[ÍB_[ÍB_[ËD$ tDT$VW|$ ׃t2t :uRFGHt:uENW:u;u_^Ëȃt+t'NW:u:u :u:_^Åtċ:uHt:uHt;uH_^UWVu M};v;sur($uwǺr $tw$uw$tw(twQtwttw#ъFGFGr$uw#ъFGr$uw#ъFGr$uwtwtwtwtwtwtwtwtwDDDDDDDDDDDDDD$uwuwuw"uw3uwE^_ÊE^_ÊFGE^_ÊFGFGE^_Ít1|9ur $vw$8vwǺr +$uw$vwuwuwuwF#шGNOr$vwF#шGFGr$vwF#шGFGFGb$vw^}E'eEfE0QUfEE}MEPiYE@EPtYY؃ڀMeM90u]M@M0oEPE YtfMfE]MfE-E]fE+fE fE0]M \eMUo=w}+UPEeEE VuWEEwt,EvjXEHtH}EP(v_^eU=Hwu)uE QQ$QQ$E QQ$ujn$]hLw!uE YY]UXu EPuU u"EePEPE u uPEP\u=HwYu,t(u EQQ$QQ$EQQ$u P$PQYhu EYYUM3SVAMWjAM[A Mt EE XtEEHtEEHtEEHtEEHu EjP#˃ _HEыP ʉHEыP ʉHEыP#σ ʉHEыP#˃ ʉHtMI tMI tMI tM y tE X  #<=%= ;uE#*= ;uE EU ʉE X EH ωH EEXE XPEHP ϋ}HPEX@)EPSjuE@t&@t&@t&@t&Xt&ߋIt|ItmIuN t~ItpIu!@@_^[]ËE ωE E EE뎋!뀋#ʀ늋#ʀU ESVWj[t2]t-SFYEtE t j /Y3_^[ètEt jYƄEjY M#tntNt;u2M wwwM wvwRwԋM wv w֋M wvww뜨 E3tE wEPQQ$!E U}E tjYwsAӊE fE;}+]tum]tMmHuEt3؋U u YEtUEVEEEEuEEhu(EE uEE$EYEYPYuV$YE^hu(YYuE YËD$t~Lw"Lw!3ɸw;T$tA=w|3ËwÊD$ tjXètjtjtjUQQE]EUQQEMEf] fMEU3ҁ} u 9UujX]Á} u 9UujM#f;ujfuE u9Utj3]UEwVu 3E0^]3fEubE u9MtTEwsjXEue E tM eN3fe;tMEQQQ$ EQQQ$E f%cUQ}EUQ}EUQ}E #E#M ȉM m EUQQMt -w]t-w]t -w]t ؛ t]VuuEPfuE+^]UeeeSVu W]=wjP7YYt(MSESP YYPe YYFFPYu>% eeeee3 U3eUUU܉}EU^F=wwjPY3Y;uE܍|CЀ}tǀ}}u uEEE@Èe}u n}t#c{uEP YYE39Et 9E] i cGd g ]썵<-<=}MEW Y]}t }]~E]=wQjSYYOEMAEFEW Y]뼋 wA wÐAF*u)E}ItBt5KKktt t ETEEIMM>E6N6u~4FuEċUԉU3u~2FudioxXrE uE&+}wX8wufEMt\EWDؠwY]F=w~/jSYYt.EMt$EFEWY]ȡwX΃}etEu~EMtteFEWY-]uFEMu1!E+t=w~/jScYYt.EMt$EFEWtY]ȡwXMWSo}YYtL}uEȀ&%u~nu }Eu u8Eu_^[9Eu EE}~E,wMj3}{Y}u:]u E]BE <]:B<-}  ]B8M8Ew"}+FϋǃDGNueEd}Ћ]-uEM<}2E+t0u=uEYx]7X.xEEo}Ѓ}P}ux=whSoYYEԋUjYSEԉUDY؀}ECЙEU؃}ME}t]}tEԋM؃EىM؃Fue}}Eȃ}E̋MԉM؉HuEY]uMSYYj0[]uEY]Ex}~E$wEM ȈED:Y}{uU }uMWuuVYY}tEMEWYEt~jZ]L 3˅t`}uR}tG wEDAt EWYE5wEPEP草fE fFFuiFE\MWPYY9u}OEȃ}cB}Et f 0 (E]-uEMu}tE\+SuEYJwX%_=w~1jSYYtAou+8}7EԋUjYcEԉUJwXjj uu趗E$uEY?uMSYY,}uvxp=w~rjSYYouh8e}EE}DЉEME}t]}E؉EwX닋EE똃=w~#hSYYt!eSnYlwX%EUuE{YpuMSYY]E}E(C}Et MfMfES#YEF;uN wDAESYF;u/MMuu uMuYYMSPMSPMYYS͋ǃnEHRHGHH:At ;EuM};EE0}~EFu ր>^zVn=wV~t$jVYYu߃^Ët$wpT$Jx A RYÃ|$tt$t$ YYVt$Wt$YWwYu_^UXESVu WHMHHHHHHtGHuJj[~QWS u5EttztueNWQPESPEPhuY3>Yt9HwuVYu6Y_^[j{jtjmjfMF]ЃMxUE#f;u,EQQ$/YHYtHt HtjX]jj]%fҋuE u}t$]Ewu $@]$]U}u3]ÍE jPEP5wu}MLw*E]ËE;tf3D$QP~YYÃS\$VtAt$F ut2u.~uV[Y;Fu ~u@F @t8t@^[F F$ F %jYËD$H ËD$H `H@HÊËËЋW|$L$ D$D$у u_ _ W|$L$ 3у u__J+;*NO/D$D$ T$T$D$l$D$d$D$T$L$t$ uh^[_^] ]] F}؃] ]] u]zك錘L$ ? sD$T$ T$3 L$ ? sD$T$ D$3 L$ ? rD$ D$T$ D$T$؃D$+D$ T$T$D$3L$T$AcL$AtL$T$AS\$$_U SVW}umE E} ;u;} VVWXVWVWVW VW@uVWVW r@ ??KUTwU;}w3fNVU# wލt7;u 9;UuueVWVWVWBVW VW@/VWVW ,;}3fNVU# wލt7;uS9;U=uujVW VWVW VW@VWVW KUTwUH;}3fNVU# wލt7;u9;Uuu\VWVW lVW@VW:VW KUTwUV;}3fNVU# wލt7;u9;UuuNVW VW@;VWVW 8KUTwUd;}wr3fNVU# wލt7;uP9;Uu u@VW@VWVW KUTwUv;}wd3fNVU# wލt7;u9;Uqu@u/VWVW ,KUTwU뇃;}wV3fNVU# wލt7;uG9;Ufuu!VW KUTwU땃;}wL3fNVU# wލt7;u9;Ueu ZKUTwU럃E;uN;M;} VGN;Mw;} n^VGN;MT;} KVGN;M1;} (VGN;M;} HVGN;M;}  VGN;M;} @VGN;M;} .VG EuNN;M_;}wC3fNVU# wލt7;u09;U !uKUTwU먃EuNN;M;}wC3fNVU# wލt7;u9;U uTKUTwU먃EuN7N;M};}wC3fNVU# wލt7;uN9;U ?uKUTwU먃EuNN;M ;}wC3fNVU# wލt7;u9;U uKUTwU먃EuNN;M;}wC3fNVU# wލt7;ul9;U ]ujKUTwU먃EuNMN;M*;}wC3fNVU# wލt7;u9;U uKUTwU먃EuNN ;M;}w?3fNVU# wލt7;u9;U wuKUTwU묃EuNN ;MwP;}w;3fNVU# wލt7;ur%9;U wuKUTwU밸B_^[]+E}3鐐8vh a*ej`I\\&2#T7XM!Gʰ`pjyeyp#>; *4yQkEs ܘ*RkyXEf]kޡСxX+sW'LB8Rj h"o8p",-'3' ߁+w05%(CwQk_z?T m{opL&z!ˢk٢Z+;98GU.h1 QhSd)cqE&mYl9sL=zf/u58'{+Yţ_88+ӣ$i: e'[F&=$6"ti`8]Fy`FTT`.bvp~|+>c{ĤҤ?> wM&4@LBP^9AlZzNjtΥܥMmR+zl~"0>>xFD '%%&g5 J$33OA34 !E%^33I40^GsK0kk2vE{{ބ ,X>ؐA|ȸIOz-t{Z5{V<)'^<sA;._[S7>_+.N#uyFR F|1yH04G""G5ws$rc*&*5 i /Ny &@iLu15tL/o><[GSnx:T]=}ps's('8DރYS,~Ӏ'GI p7fARȼ7P2j$g$̿0t7 GO?Y=iM(p7BN,-c$q.a V(Cibt7`)GipM#T(<$szOZ>#٥OCV}nF0j:)~>'jD,RT2v) #&85Y8vk`}{R!' :-To or.Gh|<S8={_#5QB0/iq+ z"3PfeAR<'WX؝vs(4vDb4<%Ѿaf^r sf_ k|Zf{d6hj*[-)',B*X002v2vvv]s ܘ*RkyXEf]kޡСxX+sW'LB8Rj h"o8p",-'3' ߁+w05(CwQk_z?T m{opL&z!ˢk٢Z+;98GU.h1 QhSd)cqE&mYl9sL=zf/u58'{+Yţ_88+ӣ$i: e'[F&=$6"ti`8]Fy`FTT`.bvp~|+>c{ĤҤ?> wM&4@LBP^9AlZzNjtΥܥMmR+zl~"0>>xFDa`G@fz5cMMJNONQNFc&eIdrde2d[ddp7R*RR R4R>RCRERRRVcMMc dc dQRQ RZ [[dOOT@a`a`SbLMyMMgyZZ[~qsgggDgOPkPpPrPfJ*JPJqS_Jsqʂ\"_M]*\_H]b"MM NMM&N+N-NNNfdddtf\cjJJzddddA6<hef9ffW<+[+hKi6ghh|iigjbjo%̑d*llhiŁm9mcmmcmzqmCB`n,oo{pcbRd(*$d/cccF*cGq\e Xq9fqeczqqhjr ssp*vz`[wt+xxwy.z yz{F\W2|%k|cw|<'x~*~~~[]SFpcS0^;MFk,Dµm  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[]\^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ "7R_o%7Vj.@aq"5Ghu*Ki9Ue}'=KVf~+8HXhz 2CYi{#6Nbr,B\ly4Fao ,<Ubt*?Xm4Me~1@Vg0ARcn ,EZq-DXk"6Me|#?Vl|,:J_t4H[gy'CUq!+?Ur(A\y6FT^s!7H`rD^|#8EWj&:Qr+AQ[h0?Si{3Pd/Kcw 0Fdr 'BYh -9J[f{0Mgx.Km&8M^l # < O f |        , C W h y        8 N f {        ' : H _ y       , A T n         $BY} 5FXgq6Pj7Pm2G^x&>Qg{ &7Lg $>OZhr (E\kx $9KWmy-Id1Oz;Kc{ #1<Ldr.>N`{ 2BTet';K^t5ER_it  : H ^ j z         !!.!;!M!Y!k!~!!!!!!""1"F"]"k"x"""""" #&#>#W#n######## $$/$@$Z$x$$$$$$$ %%+%<%G%Y%k%%%%%%%%&&3&J&`&n&&&&&&&&&''1'D'^'q''''''''(&(>(U(k(((((((()/)E)U)o)z)))))))**#*8*M*`*r*~******** +!+4+@+R+e+z++++++++++++, ,,!,*,5,@,J,R,],g,q,},,,,,,,,,,,,---&-1-=-I-S-]-g-r-}-------------... .*.4.>.G.O.Y.c.o.z...............///"/,/6/?/I/S/_/j/u//////////////00 0)030=0E0M0[0c0k0s0{00000000000000000111!1+131<1E1N1U1\1g1p1x1111111111111111111112 222'20292B2L2U2Z2^2g2n2u2|222222222222222222233333&3*323:3C3L3U3\3c3j3q3y33333333333ntdll.dllCsrAllocateCaptureBufferCsrAllocateMessagePointerCsrCaptureMessageBufferCsrCaptureMessageStringCsrCaptureTimeoutCsrClientCallServerCsrClientConnectToServerCsrFreeCaptureBufferCsrIdentifyAlertableThreadCsrNewThreadCsrProbeForReadCsrProbeForWriteCsrSetPriorityClassDbgBreakPointDbgPrintDbgPrintReturnControlCDbgPromptDbgSsHandleKmApiMsgDbgSsInitializeDbgUiConnectToDbgDbgUiContinueDbgUiWaitStateChangeDbgUserBreakPointKiRaiseUserExceptionDispatcherKiUserApcDispatcherKiUserCallbackDispatcherKiUserExceptionDispatcherLdrAccessResourceLdrAlternateResourcesEnabledLdrDisableThreadCalloutsForDllLdrEnumResourcesLdrFindEntryForAddressLdrFindResourceDirectory_ULdrFindResource_ULdrFlushAlternateResourceModulesLdrGetDllHandleLdrGetProcedureAddressLdrInitializeThunkLdrLoadAlternateResourceModuleLdrLoadDllLdrProcessRelocationBlockLdrQueryImageFileExecutionOptionsLdrQueryProcessModuleInformationLdrShutdownProcessLdrShutdownThreadLdrUnloadAlternateResourceModuleLdrUnloadDllLdrVerifyImageMatchesChecksumNPXEMULATORTABLENlsAnsiCodePageNlsMbCodePageTagNlsMbOemCodePageTagNtAcceptConnectPortNtAccessCheckNtAccessCheckAndAuditAlarmNtAccessCheckByTypeNtAccessCheckByTypeAndAuditAlarmNtAccessCheckByTypeResultListNtAccessCheckByTypeResultListAndAuditAlarmNtAccessCheckByTypeResultListAndAuditAlarmByHandleNtAddAtomNtAdjustGroupsTokenNtAdjustPrivilegesTokenNtAlertResumeThreadNtAlertThreadNtAllocateLocallyUniqueIdNtAllocateUserPhysicalPagesNtAllocateUuidsNtAllocateVirtualMemoryNtAreMappedFilesTheSameNtAssignProcessToJobObjectNtCallbackReturnNtCancelDeviceWakeupRequestNtCancelIoFileNtCancelTimerNtClearEventNtCloseNtCloseObjectAuditAlarmNtCompleteConnectPortNtConnectPortNtContinueNtCreateChannelNtCreateDirectoryObjectNtCreateEventNtCreateEventPairNtCreateFileNtCreateIoCompletionNtCreateJobObjectNtCreateKeyNtCreateMailslotFileNtCreateMutantNtCreateNamedPipeFileNtCreatePagingFileNtCreatePortNtCreateProcessNtCreateProfileNtCreateSectionNtCreateSemaphoreNtCreateSymbolicLinkObjectNtCreateThreadNtCreateTimerNtCreateTokenNtCreateWaitablePortNtCurrentTebNtDelayExecutionNtDeleteAtomNtDeleteFileNtDeleteKeyNtDeleteObjectAuditAlarmNtDeleteValueKeyNtDeviceIoControlFileNtDisplayStringNtDuplicateObjectNtDuplicateTokenNtEnumerateKeyNtEnumerateValueKeyNtExtendSectionNtFilterTokenNtFindAtomNtFlushBuffersFileNtFlushInstructionCacheNtFlushKeyNtFlushVirtualMemoryNtFlushWriteBufferNtFreeUserPhysicalPagesNtFreeVirtualMemoryNtFsControlFileNtGetContextThreadNtGetDevicePowerStateNtGetPlugPlayEventNtGetTickCountNtGetWriteWatchNtImpersonateAnonymousTokenNtImpersonateClientOfPortNtImpersonateThreadNtInitializeRegistryNtInitiatePowerActionNtIsSystemResumeAutomaticNtListenChannelNtListenPortNtLoadDriverNtLoadKeyNtLoadKey2NtLockFileNtLockVirtualMemoryNtMakeTemporaryObjectNtMapUserPhysicalPagesNtMapUserPhysicalPagesScatterNtMapViewOfSectionNtNotifyChangeDirectoryFileNtNotifyChangeKeyNtNotifyChangeMultipleKeysNtOpenChannelNtOpenDirectoryObjectNtOpenEventNtOpenEventPairNtOpenFileNtOpenIoCompletionNtOpenJobObjectNtOpenKeyNtOpenMutantNtOpenObjectAuditAlarmNtOpenProcessNtOpenProcessTokenNtOpenSectionNtOpenSemaphoreNtOpenSymbolicLinkObjectNtOpenThreadNtOpenThreadTokenNtOpenTimerNtPlugPlayControlNtPowerInformationNtPrivilegeCheckNtPrivilegeObjectAuditAlarmNtPrivilegedServiceAuditAlarmNtProtectVirtualMemoryNtPulseEventNtQueryAttributesFileNtQueryDefaultLocaleNtQueryDefaultUILanguageNtQueryDirectoryFileNtQueryDirectoryObjectNtQueryEaFileNtQueryEventNtQueryFullAttributesFileNtQueryInformationAtomNtQueryInformationFileNtQueryInformationJobObjectNtQueryInformationPortNtQueryInformationProcessNtQueryInformationThreadNtQueryInformationTokenNtQueryInstallUILanguageNtQueryIntervalProfileNtQueryIoCompletionNtQueryKeyNtQueryMultipleValueKeyNtQueryMutantNtQueryObjectNtQueryOpenSubKeysNtQueryPerformanceCounterNtQueryQuotaInformationFileNtQuerySectionNtQuerySecurityObjectNtQuerySemaphoreNtQuerySymbolicLinkObjectNtQuerySystemEnvironmentValueNtQuerySystemInformationNtQuerySystemTimeNtQueryTimerNtQueryTimerResolutionNtQueryValueKeyNtQueryVirtualMemoryNtQueryVolumeInformationFileNtQueueApcThreadNtRaiseExceptionNtRaiseHardErrorNtReadFileNtReadFileScatterNtReadRequestDataNtReadVirtualMemoryNtRegisterThreadTerminatePortNtReleaseMutantNtReleaseSemaphoreNtRemoveIoCompletionNtReplaceKeyNtReplyPortNtReplyWaitReceivePortNtReplyWaitReceivePortExNtReplyWaitReplyPortNtReplyWaitSendChannelNtRequestDeviceWakeupNtRequestPortNtRequestWaitReplyPortNtRequestWakeupLatencyNtResetEventNtResetWriteWatchNtRestoreKeyNtResumeThreadNtSaveKeyNtSaveMergedKeysNtSecureConnectPortNtSendWaitReplyChannelNtSetContextChannelNtSetContextThreadNtSetDefaultHardErrorPortNtSetDefaultLocaleNtSetDefaultUILanguageNtSetEaFileNtSetEventNtSetHighEventPairNtSetHighWaitLowEventPairNtSetInformationFileNtSetInformationJobObjectNtSetInformationKeyNtSetInformationObjectNtSetInformationProcessNtSetInformationThreadNtSetInformationTokenNtSetIntervalProfileNtSetIoCompletionNtSetLdtEntriesNtSetLowEventPairNtSetLowWaitHighEventPairNtSetQuotaInformationFileNtSetSecurityObjectNtSetSystemEnvironmentValueNtSetSystemInformationNtSetSystemPowerStateNtSetSystemTimeNtSetThreadExecutionStateNtSetTimerNtSetTimerResolutionNtSetUuidSeedNtSetValueKeyNtSetVolumeInformationFileNtShutdownSystemNtSignalAndWaitForSingleObjectNtStartProfileNtStopProfileNtSuspendThreadNtSystemDebugControlNtTerminateJobObjectNtTerminateProcessNtTerminateThreadNtTestAlertNtUnloadDriverNtUnloadKeyNtUnlockFileNtUnlockVirtualMemoryNtUnmapViewOfSectionNtVdmControlNtWaitForMultipleObjectsNtWaitForSingleObjectNtWaitHighEventPairNtWaitLowEventPairNtWriteFileNtWriteFileGatherNtWriteRequestDataNtWriteVirtualMemoryNtYieldExecutionPfxFindPrefixPfxInitializePfxInsertPrefixPfxRemovePrefixPropertyLengthAsVariantRestoreEm87ContextRtlAbortRXactRtlAbsoluteToSelfRelativeSDRtlAcquirePebLockRtlAcquireResourceExclusiveRtlAcquireResourceSharedRtlAddAccessAllowedAceRtlAddAccessAllowedAceExRtlAddAccessAllowedObjectAceRtlAddAccessDeniedAceRtlAddAccessDeniedAceExRtlAddAccessDeniedObjectAceRtlAddAceRtlAddActionToRXactRtlAddAtomToAtomTableRtlAddAttributeActionToRXactRtlAddAuditAccessAceRtlAddAuditAccessAceExRtlAddAuditAccessObjectAceRtlAddCompoundAceRtlAddRangeRtlAdjustPrivilegeRtlAllocateAndInitializeSidRtlAllocateHandleRtlAllocateHeapRtlAnsiCharToUnicodeCharRtlAnsiStringToUnicodeSizeRtlAnsiStringToUnicodeStringRtlAppendAsciizToStringRtlAppendStringToStringRtlAppendUnicodeStringToStringRtlAppendUnicodeToStringRtlApplyRXactRtlApplyRXactNoFlushRtlAreAllAccessesGrantedRtlAreAnyAccessesGrantedRtlAreBitsClearRtlAreBitsSetRtlAssertRtlCallbackLpcClientRtlCancelTimerRtlCaptureStackBackTraceRtlCharToIntegerRtlCheckForOrphanedCriticalSectionsRtlCheckRegistryKeyRtlClearAllBitsRtlClearBitsRtlCompactHeapRtlCompareMemoryRtlCompareMemoryUlongRtlCompareStringRtlCompareUnicodeStringRtlCompressBufferRtlConsoleMultiByteToUnicodeNRtlConvertExclusiveToSharedRtlConvertLongToLargeIntegerRtlConvertPropertyToVariantRtlConvertSharedToExclusiveRtlConvertSidToUnicodeStringRtlConvertToAutoInheritSecurityObjectRtlConvertUiListToApiListRtlConvertUlongToLargeIntegerRtlConvertVariantToPropertyRtlCopyLuidRtlCopyLuidAndAttributesArrayRtlCopyRangeListRtlCopySecurityDescriptorRtlCopySidRtlCopySidAndAttributesArrayRtlCopyStringRtlCopyUnicodeStringRtlCreateAclRtlCreateAndSetSDRtlCreateAtomTableRtlCreateEnvironmentRtlCreateHeapRtlCreateLpcServerRtlCreateProcessParametersRtlCreateQueryDebugBufferRtlCreateRegistryKeyRtlCreateSecurityDescriptorRtlCreateTagHeapRtlCreateTimerRtlCreateTimerQueueRtlCreateUnicodeStringRtlCreateUnicodeStringFromAsciizRtlCreateUserProcessRtlCreateUserSecurityObjectRtlCreateUserThreadRtlCustomCPToUnicodeNRtlCutoverTimeToSystemTimeRtlDeNormalizeProcessParamsRtlDebugPrintTimesRtlDecompressBufferRtlDecompressFragmentRtlDefaultNpAclRtlDeleteRtlDeleteAceRtlDeleteAtomFromAtomTableRtlDeleteCriticalSectionRtlDeleteElementGenericTableRtlDeleteNoSplayRtlDeleteOwnersRangesRtlDeleteRangeRtlDeleteRegistryValueRtlDeleteResourceRtlDeleteSecurityObjectRtlDeleteTimerRtlDeleteTimerQueueRtlDeleteTimerQueueExRtlDeregisterWaitRtlDeregisterWaitExRtlDestroyAtomTableRtlDestroyEnvironmentRtlDestroyHandleTableRtlDestroyHeapRtlDestroyProcessParametersRtlDestroyQueryDebugBufferRtlDetermineDosPathNameType_URtlDnsHostNameToComputerNameRtlDoesFileExists_URtlDosPathNameToNtPathName_URtlDosSearchPath_URtlDowncaseUnicodeStringRtlDumpResourceRtlEmptyAtomTableRtlEnableEarlyCriticalSectionEventCreationRtlEnlargedIntegerMultiplyRtlEnlargedUnsignedDivideRtlEnlargedUnsignedMultiplyRtlEnterCriticalSectionRtlEnumProcessHeapsRtlEnumerateGenericTableRtlEnumerateGenericTableWithoutSplayingRtlEqualComputerNameRtlEqualDomainNameRtlEqualLuidRtlEqualPrefixSidRtlEqualSidRtlEqualStringRtlEqualUnicodeStringRtlEraseUnicodeStringRtlExpandEnvironmentStrings_URtlExtendHeapRtlExtendedIntegerMultiplyRtlExtendedLargeIntegerDivideRtlExtendedMagicDivideRtlFillMemoryRtlFillMemoryUlongRtlFindClearBitsRtlFindClearBitsAndSetRtlFindLastBackwardRunClearRtlFindLeastSignificantBitRtlFindLongestRunClearRtlFindMessageRtlFindMostSignificantBitRtlFindNextForwardRunClearRtlFindRangeRtlFindSetBitsRtlFindSetBitsAndClearRtlFirstFreeAceRtlFormatCurrentUserKeyPathRtlFormatMessageRtlFreeAnsiStringRtlFreeHandleRtlFreeHeapRtlFreeOemStringRtlFreeRangeListRtlFreeSidRtlFreeUnicodeStringRtlFreeUserThreadStackRtlGUIDFromStringRtlGenerate8dot3NameRtlGetAceRtlGetCallersAddressRtlGetCompressionWorkSpaceSizeRtlGetControlSecurityDescriptorRtlGetCurrentDirectory_URtlGetDaclSecurityDescriptorRtlGetElementGenericTableRtlGetFirstRangeRtlGetFullPathName_URtlGetGroupSecurityDescriptorRtlGetLongestNtPathLengthRtlGetNextRangeRtlGetNtGlobalFlagsRtlGetNtProductTypeRtlGetOwnerSecurityDescriptorRtlGetProcessHeapsRtlGetSaclSecurityDescriptorRtlGetSecurityDescriptorRMControlRtlGetUserInfoHeapRtlGetVersionRtlIdentifierAuthoritySidRtlImageDirectoryEntryToDataRtlImageNtHeaderRtlImageRvaToSectionRtlImageRvaToVaRtlImpersonateLpcClientRtlImpersonateSelfRtlInitAnsiStringRtlInitCodePageTableRtlInitNlsTablesRtlInitStringRtlInitUnicodeStringRtlInitializeAtomPackageRtlInitializeBitMapRtlInitializeContextRtlInitializeCriticalSectionRtlInitializeCriticalSectionAndSpinCountRtlInitializeGenericTableRtlInitializeHandleTableRtlInitializeRXactRtlInitializeRangeListRtlInitializeResourceRtlInitializeSidRtlInsertElementGenericTableRtlInt64ToUnicodeStringRtlIntegerToCharRtlIntegerToUnicodeStringRtlInvertRangeListRtlIsDosDeviceName_URtlIsGenericTableEmptyRtlIsNameLegalDOS8Dot3RtlIsRangeAvailableRtlIsTextUnicodeRtlIsValidHandleRtlIsValidIndexHandleRtlLargeIntegerAddRtlLargeIntegerArithmeticShiftRtlLargeIntegerDivideRtlLargeIntegerNegateRtlLargeIntegerShiftLeftRtlLargeIntegerShiftRightRtlLargeIntegerSubtractRtlLargeIntegerToCharRtlLeaveCriticalSectionRtlLengthRequiredSidRtlLengthSecurityDescriptorRtlLengthSidRtlLocalTimeToSystemTimeRtlLockHeapRtlLookupAtomInAtomTableRtlLookupElementGenericTableRtlMakeSelfRelativeSDRtlMapGenericMaskRtlMergeRangeListsRtlMoveMemoryRtlMultiByteToUnicodeNRtlMultiByteToUnicodeSizeRtlNewInstanceSecurityObjectRtlNewSecurityGrantedAccessRtlNewSecurityObjectRtlNewSecurityObjectExRtlNormalizeProcessParamsRtlNtStatusToDosErrorRtlNumberGenericTableElementsRtlNumberOfClearBitsRtlNumberOfSetBitsRtlOemStringToUnicodeSizeRtlOemStringToUnicodeStringRtlOemToUnicodeNRtlOpenCurrentUserRtlPcToFileHeaderRtlPinAtomInAtomTableRtlPrefixStringRtlPrefixUnicodeStringRtlProtectHeapRtlQueryAtomInAtomTableRtlQueryEnvironmentVariable_URtlQueryInformationAclRtlQueryProcessBackTraceInformationRtlQueryProcessDebugInformationRtlQueryProcessHeapInformationRtlQueryProcessLockInformationRtlQueryRegistryValuesRtlQuerySecurityObjectRtlQueryTagHeapRtlQueryTimeZoneInformationRtlQueueWorkItemRtlRaiseExceptionRtlRaiseStatusRtlRandomRtlReAllocateHeapRtlRealPredecessorRtlRealSuccessorRtlRegisterWaitRtlReleasePebLockRtlReleaseResourceRtlRemoteCallRtlResetRtlTranslationsRtlRunDecodeUnicodeStringRtlRunEncodeUnicodeStringRtlSecondsSince1970ToTimeRtlSecondsSince1980ToTimeRtlSelfRelativeToAbsoluteSDRtlSelfRelativeToAbsoluteSD2RtlSetAllBitsRtlSetAttributesSecurityDescriptorRtlSetBitsRtlSetControlSecurityDescriptorRtlSetCriticalSectionSpinCountRtlSetCurrentDirectory_URtlSetCurrentEnvironmentRtlSetDaclSecurityDescriptorRtlSetEnvironmentVariableRtlSetGroupSecurityDescriptorRtlSetInformationAclRtlSetIoCompletionCallbackRtlSetOwnerSecurityDescriptorRtlSetSaclSecurityDescriptorRtlSetSecurityDescriptorRMControlRtlSetSecurityObjectRtlSetSecurityObjectExRtlSetThreadPoolStartFuncRtlSetTimeZoneInformationRtlSetTimerRtlSetUnicodeCalloutsRtlSetUserFlagsHeapRtlSetUserValueHeapRtlShutdownLpcServerRtlSizeHeapRtlSplayRtlStartRXactRtlStringFromGUIDRtlSubAuthorityCountSidRtlSubAuthoritySidRtlSubtreePredecessorRtlSubtreeSuccessorRtlSystemTimeToLocalTimeRtlTimeFieldsToTimeRtlTimeToElapsedTimeFieldsRtlTimeToSecondsSince1970RtlTimeToSecondsSince1980RtlTimeToTimeFieldsRtlTryEnterCriticalSectionRtlUlongByteSwapRtlUlonglongByteSwapRtlUnicodeStringToAnsiSizeRtlUnicodeStringToAnsiStringRtlUnicodeStringToCountedOemStringRtlUnicodeStringToIntegerRtlUnicodeStringToOemSizeRtlUnicodeStringToOemStringRtlUnicodeToCustomCPNRtlUnicodeToMultiByteNRtlUnicodeToMultiByteSizeRtlUnicodeToOemNRtlUniformRtlUnlockHeapRtlUnwindRtlUpcaseUnicodeCharRtlUpcaseUnicodeStringRtlUpcaseUnicodeStringToAnsiStringRtlUpcaseUnicodeStringToCountedOemStringRtlUpcaseUnicodeStringToOemStringRtlUpcaseUnicodeToCustomCPNRtlUpcaseUnicodeToMultiByteNRtlUpcaseUnicodeToOemNRtlUpdateTimerRtlUpperCharRtlUpperStringRtlUsageHeapRtlUshortByteSwapRtlValidAclRtlValidRelativeSecurityDescriptorRtlValidSecurityDescriptorRtlValidSidRtlValidateHeapRtlValidateProcessHeapsRtlVerifyVersionInfoRtlWalkFrameChainRtlWalkHeapRtlWriteRegistryValueRtlZeroHeapRtlZeroMemoryRtlpNtCreateKeyRtlpNtEnumerateSubKeyRtlpNtMakeTemporaryKeyRtlpNtOpenKeyRtlpNtQueryValueKeyRtlpNtSetValueKeyRtlpUnWaitCriticalSectionRtlpWaitForCriticalSectionRtlxAnsiStringToUnicodeSizeRtlxOemStringToUnicodeSizeRtlxUnicodeStringToAnsiSizeRtlxUnicodeStringToOemSizeSaveEm87ContextVerSetConditionMaskZwAcceptConnectPortZwAccessCheckZwAccessCheckAndAuditAlarmZwAccessCheckByTypeZwAccessCheckByTypeAndAuditAlarmZwAccessCheckByTypeResultListZwAccessCheckByTypeResultListAndAuditAlarmZwAccessCheckByTypeResultListAndAuditAlarmByHandleZwAddAtomZwAdjustGroupsTokenZwAdjustPrivilegesTokenZwAlertResumeThreadZwAlertThreadZwAllocateLocallyUniqueIdZwAllocateUserPhysicalPagesZwAllocateUuidsZwAllocateVirtualMemoryZwAreMappedFilesTheSameZwAssignProcessToJobObjectZwCallbackReturnZwCancelDeviceWakeupRequestZwCancelIoFileZwCancelTimerZwClearEventZwCloseZwCloseObjectAuditAlarmZwCompleteConnectPortZwConnectPortZwContinueZwCreateChannelZwCreateDirectoryObjectZwCreateEventZwCreateEventPairZwCreateFileZwCreateIoCompletionZwCreateJobObjectZwCreateKeyZwCreateMailslotFileZwCreateMutantZwCreateNamedPipeFileZwCreatePagingFileZwCreatePortZwCreateProcessZwCreateProfileZwCreateSectionZwCreateSemaphoreZwCreateSymbolicLinkObjectZwCreateThreadZwCreateTimerZwCreateTokenZwCreateWaitablePortZwDelayExecutionZwDeleteAtomZwDeleteFileZwDeleteKeyZwDeleteObjectAuditAlarmZwDeleteValueKeyZwDeviceIoControlFileZwDisplayStringZwDuplicateObjectZwDuplicateTokenZwEnumerateKeyZwEnumerateValueKeyZwExtendSectionZwFilterTokenZwFindAtomZwFlushBuffersFileZwFlushInstructionCacheZwFlushKeyZwFlushVirtualMemoryZwFlushWriteBufferZwFreeUserPhysicalPagesZwFreeVirtualMemoryZwFsControlFileZwGetContextThreadZwGetDevicePowerStateZwGetPlugPlayEventZwGetTickCountZwGetWriteWatchZwImpersonateAnonymousTokenZwImpersonateClientOfPortZwImpersonateThreadZwInitializeRegistryZwInitiatePowerActionZwIsSystemResumeAutomaticZwListenChannelZwListenPortZwLoadDriverZwLoadKeyZwLoadKey2ZwLockFileZwLockVirtualMemoryZwMakeTemporaryObjectZwMapUserPhysicalPagesZwMapUserPhysicalPagesScatterZwMapViewOfSectionZwNotifyChangeDirectoryFileZwNotifyChangeKeyZwNotifyChangeMultipleKeysZwOpenChannelZwOpenDirectoryObjectZwOpenEventZwOpenEventPairZwOpenFileZwOpenIoCompletionZwOpenJobObjectZwOpenKeyZwOpenMutantZwOpenObjectAuditAlarmZwOpenProcessZwOpenProcessTokenZwOpenSectionZwOpenSemaphoreZwOpenSymbolicLinkObjectZwOpenThreadZwOpenThreadTokenZwOpenTimerZwPlugPlayControlZwPowerInformationZwPrivilegeCheckZwPrivilegeObjectAuditAlarmZwPrivilegedServiceAuditAlarmZwProtectVirtualMemoryZwPulseEventZwQueryAttributesFileZwQueryDefaultLocaleZwQueryDefaultUILanguageZwQueryDirectoryFileZwQueryDirectoryObjectZwQueryEaFileZwQueryEventZwQueryFullAttributesFileZwQueryInformationAtomZwQueryInformationFileZwQueryInformationJobObjectZwQueryInformationPortZwQueryInformationProcessZwQueryInformationThreadZwQueryInformationTokenZwQueryInstallUILanguageZwQueryIntervalProfileZwQueryIoCompletionZwQueryKeyZwQueryMultipleValueKeyZwQueryMutantZwQueryObjectZwQueryOpenSubKeysZwQueryPerformanceCounterZwQueryQuotaInformationFileZwQuerySectionZwQuerySecurityObjectZwQuerySemaphoreZwQuerySymbolicLinkObjectZwQuerySystemEnvironmentValueZwQuerySystemInformationZwQuerySystemTimeZwQueryTimerZwQueryTimerResolutionZwQueryValueKeyZwQueryVirtualMemoryZwQueryVolumeInformationFileZwQueueApcThreadZwRaiseExceptionZwRaiseHardErrorZwReadFileZwReadFileScatterZwReadRequestDataZwReadVirtualMemoryZwRegisterThreadTerminatePortZwReleaseMutantZwReleaseSemaphoreZwRemoveIoCompletionZwReplaceKeyZwReplyPortZwReplyWaitReceivePortZwReplyWaitReceivePortExZwReplyWaitReplyPortZwReplyWaitSendChannelZwRequestDeviceWakeupZwRequestPortZwRequestWaitReplyPortZwRequestWakeupLatencyZwResetEventZwResetWriteWatchZwRestoreKeyZwResumeThreadZwSaveKeyZwSaveMergedKeysZwSecureConnectPortZwSendWaitReplyChannelZwSetContextChannelZwSetContextThreadZwSetDefaultHardErrorPortZwSetDefaultLocaleZwSetDefaultUILanguageZwSetEaFileZwSetEventZwSetHighEventPairZwSetHighWaitLowEventPairZwSetInformationFileZwSetInformationJobObjectZwSetInformationKeyZwSetInformationObjectZwSetInformationProcessZwSetInformationThreadZwSetInformationTokenZwSetIntervalProfileZwSetIoCompletionZwSetLdtEntriesZwSetLowEventPairZwSetLowWaitHighEventPairZwSetQuotaInformationFileZwSetSecurityObjectZwSetSystemEnvironmentValueZwSetSystemInformationZwSetSystemPowerStateZwSetSystemTimeZwSetThreadExecutionStateZwSetTimerZwSetTimerResolutionZwSetUuidSeedZwSetValueKeyZwSetVolumeInformationFileZwShutdownSystemZwSignalAndWaitForSingleObjectZwStartProfileZwStopProfileZwSuspendThreadZwSystemDebugControlZwTerminateJobObjectZwTerminateProcessZwTerminateThreadZwTestAlertZwUnloadDriverZwUnloadKeyZwUnlockFileZwUnlockVirtualMemoryZwUnmapViewOfSectionZwVdmControlZwWaitForMultipleObjectsZwWaitForSingleObjectZwWaitHighEventPairZwWaitLowEventPairZwWriteFileZwWriteFileGatherZwWriteRequestDataZwWriteVirtualMemoryZwYieldExecution_CIpow__eCommonExceptions__eEmulatorInit__eF2XM1__eFABS__eFADD32__eFADD64__eFADDPreg__eFADDreg__eFADDtop__eFCHS__eFCOM__eFCOM32__eFCOM64__eFCOMP__eFCOMP32__eFCOMP64__eFCOMPP__eFCOS__eFDECSTP__eFDIV32__eFDIV64__eFDIVPreg__eFDIVR32__eFDIVR64__eFDIVRPreg__eFDIVRreg__eFDIVRtop__eFDIVreg__eFDIVtop__eFFREE__eFIADD16__eFIADD32__eFICOM16__eFICOM32__eFICOMP16__eFICOMP32__eFIDIV16__eFIDIV32__eFIDIVR16__eFIDIVR32__eFILD16__eFILD32__eFILD64__eFIMUL16__eFIMUL32__eFINCSTP__eFINIT__eFIST16__eFIST32__eFISTP16__eFISTP32__eFISTP64__eFISUB16__eFISUB32__eFISUBR16__eFISUBR32__eFLD1__eFLD32__eFLD64__eFLD80__eFLDCW__eFLDENV__eFLDL2E__eFLDLN2__eFLDPI__eFLDZ__eFMUL32__eFMUL64__eFMULPreg__eFMULreg__eFMULtop__eFPATAN__eFPREM__eFPREM1__eFPTAN__eFRNDINT__eFRSTOR__eFSAVE__eFSCALE__eFSIN__eFSQRT__eFST__eFST32__eFST64__eFSTCW__eFSTENV__eFSTP__eFSTP32__eFSTP64__eFSTP80__eFSTSW__eFSUB32__eFSUB64__eFSUBPreg__eFSUBR32__eFSUBR64__eFSUBRPreg__eFSUBRreg__eFSUBRtop__eFSUBreg__eFSUBtop__eFTST__eFUCOM__eFUCOMP__eFUCOMPP__eFXAM__eFXCH__eFXTRACT__eFYL2X__eFYL2XP1__eGetStatusWord__isascii__iscsym__iscsymf__toascii_alldiv_allmul_alloca_probe_allrem_allshl_allshr_atoi64_aulldiv_aullrem_aullshr_chkstk_fltused_ftol_i64toa_i64tow_itoa_itow_ltoa_ltow_memccpy_memicmp_snprintf_snwprintf_splitpath_strcmpi_stricmp_strlwr_strnicmp_strupr_tolower_toupper_ui64toa_ultoa_ultow_vsnprintf_wcsicmp_wcslwr_wcsnicmp_wcsupr_wtoi_wtoi64_wtolabsatanatoiatolceilcosfabsfloorisalnumisalphaiscntrlisdigitisgraphislowerisprintispunctisspaceisupperiswalphaiswctypeiswdigitiswloweriswspaceiswxdigitisxdigitlabslogmbstowcsmemchrmemcmpmemcpymemmovememsetpowqsortsinsprintfsqrtsscanfstrcatstrchrstrcmpstrcpystrcspnstrlenstrncatstrncmpstrncpystrpbrkstrrchrstrspnstrstrstrtolstrtoulswprintftantolowertouppertowlowertowuppervsprintfwcscatwcschrwcscmpwcscpywcscspnwcslenwcsncatwcsncmpwcsncpywcspbrkwcsrchrwcsspnwcsstrwcstolwcstombswcstoul8V80OV8@`@`H R d@3dFdFd dfefD$)dddhUwddddOwddU$EDž,DžTEEEEE fXfff,df ed ed gd jQU>]Y(@u@t3Džd,jPR*PJ FFF V$$t$Ϻ# Ð IwHwHwHw IwHwHwHw IwHwHwHw IwHwHwHw IwHwmHwHw IwHwHwHw IwHwHwHw IwHwHwHwQNwrPw&ewewNw-NwRwERwZw\cwpw*\wIwIwIwIwpwpwpwpwpwdwpwpwpwpwpwpwIwpwpwpwONwpPw&ewew+NwNwCRwRwVcw\cw\w*\wdwdwpwpwJNwkPwewdw&Nw Nw>RwRwVcw\cw*\w*\w,wpwpwpwMwOwIdw2dwMwMwRw RwyZwpw"_w_wqw~wwwMwOw dw dwMwMwRw Rw [wpw`w`wpw[wpwbwMwPwrdw[dwMwMw*Rw4RwZwpwM]wH]wwpww"wMwdOwcwcwLwyMwQwQwZwpwawawgw[whwSbwgwQgwsgwgwgwgwDgwpwfzwJwqwfJwjwPJw7wTwFcw5cwpwpwfwtfwpwpw*JwJwʂwrwSw_Jwsqwpwpwpwqw@wpwpwpwpwEw~wfPff f=#fXkPfPf#f؏wwwww5w5w5w%w,ww ww5w=w-ww%w-wwfм,wf;fd  u:,wwJBBZ BjQRGtw ?f#fh,w_w ww=w5w-w-w%wwww 5w5w5wwwd5dd5WVUT$$SRQPd=dtL|$,&dgd"juOd=dff@gރ$BwM7d=h뚁ttttu s\$$Ed dXYZ[]^_^&G$<u?&D$84|$,fhSIwd=Dw&G$D$84&G&G$D$84&{4p4&G^4&7M&7B|$,fhSIwd=4@LsCw`CwG|$,dgdgd eded"j|$,&ftĀ؀r(\$$Ed dXYZ[]^_dgdd\$$E ÉD$$dD$ D$8D$TEwEw4EwtEwEwdNd^d6d=dg% 2H.dd$(hlwhalwlw@s 밁d$(hlwؽjw۽XwwhFew Lry}wݽ{wրudd2o 3ۋBd%uHdBd2o d7d_dOÀu(2dgdh .etÀt׀@ud g@dhudGKwPwPwKKw>KwJwJwKKw>KwJwJwJwKwKKwh}Pwd56f3ff3f+fz رh}Pwd563 Q 3+‹3wh}Pwd566n 3 h}Pwd56N6n66  U  hFewdNd^d6 Owd=d G<t_ydWdG2f3pڋ3 d%d g`dhtd g ÀBtdGdWd?2f3qd gdhuǁ`ɇ֋ûڋ d%SwSwKKwxKwrwrwKKwxKwq|wq|wKwxKwJwJwJwKwKwuRwwwq|w/KwuRwwwq|w/KwJwJwKw/KwJwJwJwKwKwhRwqhPRwghRwhPRwhRwhPRwhRwhPRwhFewdNd^d6Qwd=dGf=%Ӌd_d2f3ہ+qd gdh9`3;wr ;wd%hFewdNd^d6fQwd=dgf= dQddIS;%Q+Ћ%Ks%+ȋ% %t dgdhudOBtwԁ?}d_d7d=3hOw{ʀ s 3ۺ# tFBd g di tO # tdfJ# l û?$N<|> d g ŀdfdht?=@dg$ dgB:=@(!d g`d%| td g Z @d g`dh3di "@ td g z fd g Y|Cց Ad g ŀ*df|dh2@dg$ dgB2@|ց d g ց P`ց ^d g ŀB(ց &d g |D ƋӁ d g 3ŀdf5dh@8dg$ dgB|@jc| ƋӁ `d g 3Ӂ€E 7R_ ƋӁ d g 3ŀ# ƋӁ d g 3t-u dgAdgd_dOd?ŀBtbw3~`?Ӄ?ي3 | ׇ t.dg di u6sdfr 3ȇڊt3dg di2$ <udfCÁBd g di u t(3ۋdi2$ <u3df uv ۱uÁÁddi2$ <6^d gtdht|FA3Ҁ rҋ3B td gUd gd g03ۋd%i2 Odf8&dhtd g(3d%i4"  KOt>3@@dgdhdgdhu"h\wd5d_dOd?ŀBtnwf3Ɂ~lӁ t;d g di Àt Ӂ tdf $ 6dh|'A33 Ӂ td god g033d%i2 udfvddhd g(d%i4" @K:tUu&dgAdht6wdgh\wd5d_dOd?ŀBtew3~]ǃ t,dg di uAs dfCtr3+6Çׇtdg d%i2 udfCs=tTu%dgAdht6fwdgh\wd5d_dOd?ŀBtcw3~\ǃ t*dg di u@s dfCt3+6fÇׇtdg d%i2 udfCs>d5'r-s y߃6>6^(wudgdhtA66FdgAdht66F6fFd5dG6^6fNIـ s 3ۇ3dkdG dZdW dFd~t)dt*ddddGdFdGdGdFdG"uÇuódwdwewfwdwdwewfwewew=ewfwewewew5fwd$(hFewhewrd$(hew`d$(hFewhew}d$(hewkd$(hFewhewd$(hewd$(hFewhewd$(hewd$(huewdNd^d6@cwdgfedGf%f:un;|hhd9_ud97th2dfÁd$(hFew렁d$(떁d$(huewdNd^d6뇁d$(hFewd$(d%fdf@tTd5dFÁ@s d5dt%d5dFÃLtw!dFd5ddHddd-fdG dfÀt'tۀtfdgAdhudfEudgdGdgdhuwdgdhtd=dGdFdGdddF@dFdF d=dGdFdGdddF@udgdhWdN@kwkwkwkwkwkwkwkwkwkwkwkwkwkwkwKwlw3+dG =@}=~pdfG  xf}dgdht)di"t#3Nd7d_dO-`=@|3@do dht(=fd_d7do 3d=dg`=FdgBdo 3ۋrdG<À xdBe yBmwBmwlwflwBmwBmwlwflwKwKwKwflwwlwwlwwlwKwKwfdG<A ~df@BAC|>;|8;|2t(+ڋƋӵEu ʍ|9ീ d5ށ@s3 df{ f~+dd0n dVdf~ dNlwdfûdhtǁ`d gfddWd 3+ |U+s;sXʋsMs | u t@ }3tbр+|M+sB 33ý+Ћrd5ddFfdfF dFBOE3Ëtō|93dGMqMqFu$K$u4;3f>3FtߋMfW)W@C8VP @fffH{K0xʉM PV AN,;~~A8U;u ;A Ujh@UwhۀwdPd%QQSVWe3ۉ4[E8,we E u E3j Y31EЊHKfxffNjUx9u+j[㉝XXN^ Hz(eFEE؍x}܀}tEx-eE MEEȃ} Eȃ}V Eȃ}r xuԋFE; E; ;^vF EjhEPjPjE/E+EfA@ EAMHPF1AF EHP Q M;AE;rfxfUx ; XFTXr8 M3ʃ(}YUjhwhۀwdPd%QQlSVWe}}̀eEUtr] _`}3reFwn~@dMt@u7u3E=s&R@PZtMd _^[ Eux2 EFEG ujEPVWu܋E=sGfEЍx]9 ]KMFN CEG(MpE[;G rO(;O$W= fx}E;tHMfUf;wEPUNV HMЋEH(뇀}tExj USVW} ]G+;t FoEGu D4t _^[]ȁw})F$GuDN F;H{ F)E)K(fGfuffDGDXx8#e yuVS2 tUQSVuW\#F#F i~#d@0;p#~P^P;~#VWV$ F uu xx~@f@j@T_Ow3_^[}@ ] U$S]VW|u eFDXE#‹ȉE+fM\fNft;Me<΋#ʉM +M fMfu FɉM+9E M)E } }uEE h@PEPjuEu}>u uuE M A(EfwfFC(q8fEC @f}rxxxE9ujZMXEPFUVUUV u2pufE_^[ UE SVW} E@ E2ˋLXɉM;q(;AEjPQW  mMjQPW:uVW6_^[uEvup}txgeehEPEPjsȉM؅GfUxX;tXf;;w9] yExUE=]fe 43΃EffL;f;rw@U VuW3F9xDHD_^fNjUx(9u+ j[㉝$ XXhx;|fUf;Pwm3Ɋ8:w8:w@EPUċHHx Dy;Y)^(E؃PM+MH`PFUQE@  @eEEhPEPj5uuE HP s JJJRSW)"USVWIEE +Eˋu ~CEE;EffE +EG;E E +EFfM ]fNfMfMNE  M]N MNMF U^~ V$NF(t PuVUM+tXfQGW~8SfGWZ_^[m EM^]80uj0PFuf|fs_fǍx9u+j[㉝XX(Urfx;tXf;;v䉅XWVuUEE t7DžT\DždXEhTPQdM d|QF4eE#PVWSdE d|QaF4ejXËed dHEAP[%wZ]: Failing creating uncommitted range (%x for %x) uu {d@0@ @ ,Ph"wYYu uh.w @hPFPuNME$EhPGPtO]hPFPtNhÍx9rj[㍄8X]QD$3ɉ@HH HUME;MSVWwr;E s _^[]$u(u$uQPuu puE tNu }VW&؅| G Gd@0VjpaU U eVuJ BbMWEy;E;ArOw9ErFB;Awr;sA9B r*w9Br!B9Aw8r9s0A ;Bw(rA;s뛋I r9J >w1E_^ uRQVEFJB 1NUQM SVW}A3$wE UX;]P;Qwr9sP ;QrDwP;r;Q;Pwr;sQ ;Pr#wQ;r} t@uEt/HIUuX;Yrw;vP UEl_^[ uSVAQ 0FA;Gw r;sGAI ;O r w;GvGO Gt } u$G3뢋2AQ 0FVt$Vyu ^NfFNP 2H V3Ud@0j(hRRlepHt2M`M HMHMH Mf`HM HMH]UUS] VJWE{9}}rR uUU;Pw U;@+p@P;tw}]}}9xwr8;}sx ;}r>wx;}r4};xwr89}sx9}rw89}r@P;u}] x9}}BCuSls~^9]}EH ;Nw H;FNVyA;tDuQ Qu PGύV8ׄt @N_^[}뀋F Cd@0Vjp}G_9]EuNjEuPu _uF Vu CGUQQS]VW EqQ;ډuQ};w 9EAtu9Uw 9E ;y w}rE;AwsQAz7;:;} u#z;}uz;}uz ;}u}9zt^]֍~‹uj;E u;UuA;EuA ;uE9At:VF;؋ΉUuŋE|K C_^[uQR]E؋Q APd@0QjpeUQeSVuWyA;}tAt$QAZ;;tFZ;] tC׍_U 9Qu(Q Pd@0Qjp*N Feϋ뒋}QRE| N FlE_^[U US] VJ BW{HEeEEEpH;t2P jP Q`EP9E|sNƋ1;uыUuE;tKC K0uFEAEd@0RjpId@0Sjp5E_^[K CHEH1U;jtPSgƍNuSWUQQSVWd@0j(hRRlepEtxUj YBtfXJXM1V;ʉUtId@0j(hRRlept4j YSHP E K0F9EEuE_^[um3SVt$ W~ t _^[\$CFC F CFx;t+PtVHP 1 NVe3US]VWCt0K{A0;td@0Qjp΍Fd@0Sjp_^[]VW|$ gg A0;tQ QPw΍F_^UEPEPu=u E,3(|u(E$u$jQPEu uuuu PM,UVW}GEu}(uM;Hw M;H;wr9U s 9MrRw9UrK;wr;U sH ;r9wH;M r/38M t@u"UPu8M$t9Ht9M0tNPu,U0tCu(EPWEX!u;p wjM ;H^_^],2UES]VW}H3+E3Pu VWg8+U;8Er 9E *+E 3;w ;EM jM [;w ;M ;w ;} 39]9] E$$E$EPEPuMzu03Mu,ЃSu$uu(RQVEWPu`EjZ@+};wYr;wS3Pu VWm7+jEZʃ;ur,w;} r%u0u,Su$uu(QP둋E48p3_^[0 L$T$V3rq 2;t(FVtQQʋT$ ^ AAAL$UMSV@;A t ^[] A3;t18]t8@Q;tp;uU8]t$B YP;uYE 봋@ ƋB@t8]pqtAM 3눋@AUQSVW}u W9E E0N;MFtL^v~;t2VJt\FMtQPu7E ~;uыE}M1Vt:FMtQPWE |Eϋ}E WOE _^[E H O @ GߋT$SVW23ۃ33~;tJ^;r%w;vjjjjSRPQt$0|HNF 7j[Ã~9|$uЃ;rw;vSSSSjjPQt$0;;|3_^[HEAP[%wZ]: Ignoring RtlDestroyHeap( NULL ) d@0@ @ ,Ph0w#YYhV2_^[]>F+떰2ww@ww0123456789ABCDEF0123456789ABCDEF2w\wwLW)Lz2"&v/ڋ*7\r O /T)#_ck8]tTUQ?b) :*$*u.C@zT\X'mtq_s1C@wtQId>2%tYbH8b(7ڕƻPz "&O|AfKBtR;-2<&ZA`x1Rh#b'97|$ ys;+U%y,|61Ba9^7e 8$=MOu!@~ jWfb{ P{_D#x %_3^7B@`C 2+=v;$^iwV$u/mR_x.ј~/M5#cxmg|02?lyi=+F94ySPtK,^ zZ3 s9kbCFb\1 %GTOxDݸ= U[@@>V@V@@@@pA @ @AC H&U [d\5\7n~rxlzoIP\^sDuy@<%!&l&(M(OUX5WXL8bc8 9Ya$?57B  D  E  lK" " $P$ $ P& ( ,R* + S. 4 T^ !\h$STATUS_WAIT_0 $STATUS_WAIT_1 $STATUS_WAIT_2 $STATUS_WAIT_3 (STATUS_WAIT_63 8STATUS_ABANDONED_WAIT_0 <STATUS_ABANDONED_WAIT_63 (STATUS_USER_APC ,STATUS_KERNEL_APC (STATUS_ALERTED (STATUS_TIMEOUT xThe operation that was requested is pending completion. A reparse should be performed by the Object Manager since the name of the file resulted in a symbolic link. Returned by enumeration APIs to indicate more information is available to successive calls. Indicates not all privileges referenced are assigned to the caller. This allows, for example, all privileges to be disabled without having to know exactly which privileges are assigned. Some of the information to be translated has not been translated. An open/create operation completed while an oplock break is underway. hA new volume has been mounted by a file system. This success level status indicates that the transaction state already exists for the registry sub-tree, but that a transaction commit was previously aborted. The commit has now been completed. This indicates that a notify change request has been completed due to closing the handle which made the notify change request. This indicates that a notify change request is being completed and that the information is not being returned in the caller's buffer. The caller now needs to enumerate the files to find the changes. {No Quotas} No system quota limits are specifically set for this account. {Connect Failure on Primary Transport} An attempt was made to connect to the remote server %hs on the primary transport, but the connection failed. The computer WAS able to connect on a secondary transport. PPage fault was a transition fault. PPage fault was a demand zero fault. PPage fault was a demand zero fault. PPage fault was a demand zero fault. Page fault was satisfied by reading from a secondary storage device. \Cached page was locked during operation. LCrash dump exists in paging file. TSpecified buffer contains all zeros. A reparse should be performed by the Object Manager since the name of the file resulted in a symbolic link. The device has succeeded a query-stop and its resource requirements have changed. The translator has translated these resources into the global space and no further translations should be performed. The directory service evaluated group memberships locally, as it was unable to contact a global catalog server. @Debugger handled exception 0Debugger continued {Object Exists} An attempt was made to create an object and the object name already existed. {Thread Suspended} A thread termination occurred while the thread was suspended. The thread was resumed, and termination proceeded. ${Working Set Range Error} An attempt was made to set the working set minimum or maximum to values which are outside of the allowable range. ({Image Relocated} An image file could not be mapped at the address specified in the image file. Local fixups must be performed on this image. This informational level status indicates that a specified registry sub-tree transaction state did not yet exist and had to be created. {Segment Load} A virtual DOS machine (VDM) is loading, unloading, or moving an MS-DOS or Win16 program segment image. An exception is raised so a debugger can load, unload or track symbols and breakpoints within these 16-bit segments. L{Local Session Key} A user session key was requested for a local RPC connection. The session key returned is a constant value and not unique to this connection. P{Invalid Current Directory} The process cannot switch to the startup current directory %hs. Select OK to set current directory to %hs, or select CANCEL to exit. ({Serial IOCTL Complete} A serial I/O operation was completed by another write to a serial port. (The IOCTL_SERIAL_XOFF_COUNTER reached zero.) L{Registry Recovery} One of the files containing the system's Registry data had to be recovered by use of a log or alternate copy. The recovery was successful. d{Redundant Read} To satisfy a read request, the NT fault-tolerant file system successfully read the requested data from a redundant copy. This was done because the file system encountered a failure on a member of the fault-tolerant volume, but was unable to reassign the failing area of the device. d{Redundant Write} To satisfy a write request, the NT fault-tolerant file system successfully wrote a redundant copy of the information. This was done because the file system encountered a failure on a member of the fault-tolerant volume, but was not able to reassign the failing area of the device. 4{Serial IOCTL Timeout} A serial I/O operation completed because the time-out period expired. (The IOCTL_SERIAL_XOFF_COUNTER had not reached zero.) @{Password Too Complex} The Windows password is too complex to be converted to a LAN Manager password. The LAN Manager password returned is a NULL string. X{Machine Type Mismatch} The image file %hs is valid, but is for a machine type other than the current machine. Select OK to continue, or CANCEL to fail the DLL load. {Partial Data Received} The network transport returned partial data to its client. The remaining data will be sent later. {Expedited Data Received} The network transport returned data to its client that was marked as expedited by the remote system. {Partial Expedited Data Received} The network transport returned partial data to its client and this data was marked as expedited by the remote system. The remaining data will be sent later. {TDI Event Done} The TDI indication has completed successfully. {TDI Event Pending} The TDI indication has entered the pending state. @Checking file system on %wZ D{Fatal Application Exit} %hs The specified registry key is referenced by a predefined handle. ${Page Unlocked} The page protection of a locked page was changed to 'No Access' and the page was unlocked from memory and from the process. %hs {Page Locked} One of the pages to lock was already locked. @Application popup: %1 : %2 4STATUS_ALREADY_WIN32 Exception status code used by Win32 x86 emulation subsystem. Exception status code used by Win32 x86 emulation subsystem. Exception status code used by Win32 x86 emulation subsystem. Exception status code used by Win32 x86 emulation subsystem. Exception status code used by Win32 x86 emulation subsystem. Exception status code used by Win32 x86 emulation subsystem. Exception status code used by Win32 x86 emulation subsystem. {Machine Type Mismatch} The image file %hs is valid, but is for a machine type other than the current machine. A yield execution was performed and no thread was available to run. hThe resumable flag to a timer API was ignored. The arbiter has deferred arbitration of these resources to its parent The device "%hs" has detected a CardBus card in its slot, but the firmware on this system is not configured to allow the CardBus controller to be run in CardBus mode. The operating system will currently accept only 16-bit (R2) pc-cards on this controller. Exception status code used by Win32 x86 emulation subsystem. The CPUs in this multiprocessor system are not all the same revision level. To use all processors the operating system restricts itself to the features of the least capable processor in the system. Should problems occur with this system, contact the CPU manufacturer to see if this mix of processors is supported. 4The system has awoken @Debugger will reply later. LDebugger can not provide handle. @Debugger terminated thread. DDebugger terminated process. 8Debugger got control C. \Debugger printerd exception on control C. LDebugger recevice RIP exception. LDebugger received control break. A UUID that is valid only on this computer has been allocated. pSome data remains to be sent in the request buffer. The Client Drive Mapping Service Has Connected on Terminal Connection. The Client Drive Mapping Service Has Disconnected on Terminal Connection. {EXCEPTION} Guard Page Exception A page of memory that marks the end of a data structure, such as a stack or an array, has been accessed. {EXCEPTION} Alignment Fault A datatype misalignment was detected in a load or store instruction. x{EXCEPTION} Breakpoint A breakpoint has been reached. {EXCEPTION} Single Step A single step or trace operation has just been completed. {Buffer Overflow} The data was too large to fit into the specified buffer. {No More Files} No more files were found which match the file specification. {Kernel Debugger Awakened} the system debugger was awakened by an interrupt. {Handles Closed} Handles to objects have been automatically closed as a result of the requested operation. {Non-Inheritable ACL} An access control list (ACL) contains no components that can be inherited. `{GUID Substitution} During the translation of a global identifier (GUID) to a Windows security ID (SID), no administratively-defined GUID prefix was found. A substitute prefix was used, which will not compromise system security. However, this may provide a more restrictive access than intended. {Partial Copy} Due to protection conflicts not all the requested bytes could be copied. d{Out of Paper} The printer is out of paper. {Device Power Is Off} The printer power has been turned off. t{Device Offline} The printer has been taken offline. d{Device Busy} The device is currently busy. {No More EAs} No more extended attributes (EAs) were found for the file. {Illegal EA} The specified extended attribute (EA) name contains at least one illegal character. {Inconsistent EA List} The extended attribute (EA) list is inconsistent. {Invalid EA Flag} An invalid extended attribute (EA) flag was set. h{Verifying Disk} The media has changed and a verify operation is in progress so no reads or writes may be performed to the device, except those used in the verify operation. {Too Much Information} The specified access control list (ACL) contained more information than was expected. ,This warning level status indicates that the transaction state already exists for the registry sub-tree, but that a transaction commit was previously aborted. The commit has NOT been completed, but has not been rolled back either (so it may still be committed if desired). {No More Entries} No more entries are available from an enumeration operation. `{Filemark Found} A filemark was detected. d{Media Changed} The media may have changed. h{I/O Bus Reset} An I/O bus reset was detected. t{End of Media} The end of the media was encountered. lBeginning of tape or partition has been detected. d{Media Changed} The media may have changed. LA tape access reached a setmark. During a tape access, the end of the data written is reached. lThe redirector is in use and cannot be unloaded. dThe server is in use and cannot be unloaded. xThe specified connection has already been disconnected. HA long jump has been executed. tThe device has indicated that cleaning is necessary. The device has indicated that it's door is open. Further operations require it closed and secured. XDebugger did not handle the exception. {Operation Failed} The requested operation was unsuccessful. {Not Implemented} The requested operation is not implemented. {Invalid Parameter} The specified information class is not a valid information class for the specified object. The specified information record length does not match the length required for the specified information class. The instruction at "0x%08lx" referenced memory at "0x%08lx". The memory could not be "%s". 8The instruction at "0x%08lx" referenced memory at "0x%08lx". The required data was not placed into memory because of an I/O error status of "0x%08lx". xThe pagefile quota for the process has been exhausted. LAn invalid HANDLE was specified. An invalid initial stack was specified in a call to NtCreateThread. An invalid initial start address was specified in a call to NtCreateThread. PAn invalid Client ID was specified. hAn attempt was made to cancel or set a timer that has an associated APC and the subject thread is not the thread that originally set the timer with an associated APC routine. |An invalid parameter was passed to a service or function. dA device which does not exist was specified. h{File Not Found} The file %hs does not exist. The specified request is not a valid operation for the target device. The end-of-file marker has been reached. There is no valid data in the file beyond this marker. {Wrong Volume} The wrong volume is in the drive. Please insert volume %hs into drive %hs. {No Disk} There is no disk in the drive. Please insert a disk into drive %hs. {Unknown Disk Format} The disk in drive %hs is not formatted properly. Please check the disk, and reformat if necessary. |{Sector Not Found} The specified sector does not exist. {Still Busy} The specified I/O request packet (IRP) cannot be disposed of because the I/O operation is not complete. {Not Enough Quota} Not enough virtual memory or paging file quota is available to complete the specified operation. {Conflicting Address Range} The specified address range conflicts with the address space. dAddress range to unmap is not a mapped view. HVirtual memory cannot be freed. TSpecified section cannot be deleted. An invalid system service was specified in a system service call. {EXCEPTION} Illegal Instruction An attempt was made to execute an illegal instruction. {Invalid Lock Sequence} An attempt was made to execute an invalid lock sequence. {Invalid Mapping} An attempt was made to create a view for a section which is bigger than the section. {Bad File} The attributes of the specified mapping file for a section of memory cannot be read. {Already Committed} The specified address range is already committed. {Access Denied} A process has requested access to an object, but has not been granted those access rights. {Buffer Too Small} The buffer is too small to contain the entry. No information has been written to the buffer. <{Wrong Type} There is a mismatch between the type of object required by the requested operation and the type of object that is specified in the request. {EXCEPTION} Cannot Continue Windows cannot continue from this exception. An invalid exception disposition was returned by an exception handler. 8Unwind exception code. An invalid or unaligned stack was encountered during an unwind operation. An invalid unwind target was encountered during an unwind operation. An attempt was made to unlock a page of memory which was not locked. TDevice parity error on I/O operation. An attempt was made to decommit uncommitted virtual memory. An attempt was made to change the attributes on memory that has not been committed. Invalid Object Attributes specified to NtCreatePort or invalid Port Attributes specified to NtConnectPort Length of message passed to NtRequestPort or NtRequestWaitReplyPort was longer than the maximum message allowed by the port. pAn invalid combination of parameters was specified. An attempt was made to lower a quota limit below the current usage. {Corrupt Disk} The file system structure on the disk is corrupt and unusable. Please run the Chkdsk utility on the volume %hs. 4Object Name invalid. 8Object Name not found. @Object Name already exists. Attempt to send a message to a disconnected communication port. An attempt was made to attach to a device that was already attached to another device. lObject Path Component was not a directory object. h{Path Not Found} The path %hs does not exist. lObject Path Component was not a directory object. h{Data Overrun} A data overrun error occurred. \{Data Late} A data late error occurred. {Data Error} An error in reading or writing data occurred. {Bad CRC} A cyclic redundancy check (CRC) checksum error occurred. {Section Too Large} The specified section is too big to map the file. TThe NtConnectPort request is refused. The type of port handle is invalid for the operation requested. A file cannot be opened because the share access flags are incompatible. pInsufficient quota exists to complete the operation dThe specified page protection was not valid. An attempt to release a mutant object was made by a thread that was not the owner of the mutant object. An attempt was made to release a semaphore such that its maximum count would have been exceeded. An attempt to set a processes DebugPort or ExceptionPort was made, but a port already exists in the process. An attempt was made to query image information on a section which does not map an image. An attempt was made to suspend a thread whose suspend count was at its maximum. An attempt was made to suspend a thread that has begun termination. An attempt was made to set the working set limit to an invalid value (minimum greater than maximum, etc). A section was created to map a file which is not compatible to an already existing section which maps the same file. A view to a section specifies a protection which is incompatible with the initial view's protection. An operation involving EAs failed because the file system does not support EAs. pAn EA operation failed because EA set is too large. An EA operation failed because the name or EA index is invalid. lThe file for which EAs were requested has no EAs. PThe EA is corrupt and non-readable. A requested read/write cannot be granted due to a conflicting file lock. A requested file lock cannot be granted due to other existing locks. A non close operation has been requested of a file object with a delete pending. An attempt was made to set the control attribute on a file. This attribute is not supported in the target file system. 4Indicates a revision number encountered or specified is not one known by the service. It may be a more recent revision than the service is aware of. hIndicates two revision levels are incompatible. Indicates a particular Security ID may not be assigned as the owner of an object. Indicates a particular Security ID may not be assigned as the primary group of an object. An attempt has been made to operate on an impersonation token by a thread that is not currently impersonating a client. XA mandatory group may not be disabled. There are currently no logon servers available to service the logon request. A specified logon session does not exist. It may already have been terminated. TA specified privilege does not exist. hA required privilege is not held by the client. |The name provided is not a properly formed account name. PThe specified user already exists. PThe specified user does not exist. PThe specified group already exists. PThe specified group does not exist. 4The specified user account is already in the specified group account. Also used to indicate a group cannot be deleted because it contains a member. The specified user account is not a member of the specified group account. Indicates the requested operation would disable or delete the last remaining administration account. This is not allowed to prevent creating a situation in which the system cannot be administrated. When trying to update a password, this return status indicates that the value provided as the current password is not correct. HWhen trying to update a password, this return status indicates that the value provided for the new password contains values that are not allowed in passwords. LWhen trying to update a password, this status indicates that some password update rule has been violated. For example, the password may not meet length criteria. The attempted logon is invalid. This is either due to a bad username or authentication information. |Indicates a referenced user name and authentication information are valid, but some user account restriction has prevented successful authentication (such as time-of-day restrictions). The user account has time restrictions and may not be logged onto at this time. The user account is restricted such that it may not be used to log on from the source workstation. \The user account's password has expired. The referenced account is currently disabled and may not be logged on to. None of the information to be translated has been translated. The number of LUIDs requested may not be allocated with a single allocation. hIndicates there are no more LUIDs to allocate. Indicates the sub-authority value is invalid for the particular use. \Indicates the ACL structure is not valid. \Indicates the SID structure is not valid. |Indicates the SECURITY_DESCRIPTOR structure is not valid. Indicates the specified procedure address cannot be found in the DLL. {Bad Image} The application or DLL %hs is not a valid Windows image. Please check this against your installation diskette. tAn attempt was made to reference a token that doesn't exist. This is typically done by referencing the token associated with a thread when the thread is not impersonating a client. Indicates that an attempt to build either an inherited ACL or ACE was not successful. This can be caused by a number of things. One of the more probable causes is the replacement of a CreatorId with an SID that didn't fit into the ACE or ACL. pThe range specified in NtUnlockFile was not locked. hAn operation failed because the disk was full. The GUID allocation server is [already] disabled at the moment. The GUID allocation server is [already] enabled at the moment. Too many GUIDs were requested from the allocation server at once. The GUIDs could not be allocated because the Authority Agent was exhausted. The value provided was an invalid value for an identifier authority. There are no more authority agent values available for the given identifier authority value. `An invalid volume label has been specified. XA mapped section could not be extended. tSpecified section to flush does not map a data file. Indicates the specified image file did not contain a resource section. Indicates the specified resource type cannot be found in the image file. Indicates the specified resource name cannot be found in the image file. P{EXCEPTION} Array bounds exceeded. d{EXCEPTION} Floating-point denormal operand. d{EXCEPTION} Floating-point division by zero. `{EXCEPTION} Floating-point inexact result. h{EXCEPTION} Floating-point invalid operation. T{EXCEPTION} Floating-point overflow. \{EXCEPTION} Floating-point stack check. X{EXCEPTION} Floating-point underflow. X{EXCEPTION} Integer division by zero. H{EXCEPTION} Integer overflow. T{EXCEPTION} Privileged instruction. An attempt was made to install more paging files than the system supports. The volume for a file has been externally altered such that the opened file is no longer valid. When a block of memory is allotted for future updates, such as the memory allocated to hold discretionary access control and primary group information, successive updates may exceed the amount of memory originally allotted. Since quota may already have been charged to several processes which have handles to the object, it is not reasonable to alter the size of the allocated memory. Instead, a request that requires more memory than has been allotted must fail and the STATUS_ALLOTED_SPACE_EXCEEDED error returned. |Insufficient system resources exist to complete the API. An attempt has been made to open a DFS exit path control file. <STATUS_DEVICE_DATA_ERROR @STATUS_DEVICE_NOT_CONNECTED @STATUS_DEVICE_POWER_FAILURE Virtual memory cannot be freed as base address is not the base of the region and a region size of zero was specified. An attempt was made to free virtual memory which is not allocated. The working set is not big enough to allow the requested pages to be locked. <{Write Protect Error} The disk cannot be written to because it is write protected. Please remove the write protection from the volume %hs in drive %hs. \{Drive Not Ready} The drive is not ready for use; its door may be open. Please check drive %hs and make sure that a disk is inserted and that the drive door is closed. The specified attributes are invalid, or incompatible with the attributes for the group as a whole. A specified impersonation level is invalid. Also used to indicate a required impersonation level was not provided. An attempt was made to open an Anonymous level token. Anonymous tokens may not be opened. xThe validation information class requested was invalid. The type of a token object is inappropriate for its attempted use. The type of a token object is inappropriate for its attempted use. $An attempt was made to execute an instruction at an unaligned address and the host system does not support unaligned instruction references. xThe maximum named pipe instance count has been reached. An instance of a named pipe cannot be found in the listening state. |The named pipe is not in the connected or closing state. The specified pipe is set to complete operations and there are current I/O operations queued so it cannot be changed to queue operations. The specified handle is not open to the server end of the named pipe. xThe specified named pipe is in the disconnected state. lThe specified named pipe is in the closing state. pThe specified named pipe is in the connected state. pThe specified named pipe is in the listening state. lThe specified named pipe is not in message mode. {Device Timeout} The specified I/O operation on %hs was not completed before the time-out period expired. xThe specified file has been closed by another process. 8Profiling not started. 8Profiling not stopped. The passed ACL did not contain the minimum required information. The file that was specified as a target is a directory and the caller specified that it could be anything but a directory. TThe network request is not supported. XThis remote computer is not listening. XA duplicate name exists on the network. PThe network path cannot be located. 4The network is busy. @This device does not exist. lThe network BIOS command limit has been reached. `An I/O adapter hardware error has occurred. PThe network responded incorrectly. TAn unexpected network error occurred. TThe remote adapter is not compatible. @The printer queue is full. Space to store the file waiting to be printed is not available on the server. `The requested print file has been canceled. DThe network name was deleted. <Network access is denied. ${Incorrect Network Resource Type} The specified device type (LPT, for example) conflicts with the actual device type on the remote resource. {Network Name Not Found} The specified share name cannot be found on the remote server. The name limit for the local computer network adapter card was exceeded. dThe network BIOS session limit was exceeded. \File sharing has been temporarily paused. (No more connections can be made to this remote computer at this time because there are already as many connections as the computer can accept. lPrint or disk redirection is temporarily paused. HA network data fault occurred. The number of active profiling objects is at the maximum and no more may be started. {Incorrect Volume} The target file of a rename request is located on a different device than the source of the rename request. The file specified has been renamed and thus cannot be modified. {Network Request Timeout} The session with a remote server has been disconnected because the time-out interval for a request has expired. Indicates an attempt was made to operate on the security of an object that does not have security associated with it. Used to indicate that an operation cannot continue without blocking for I/O. Used to indicate that a read operation was done on an empty pipe. $Configuration information could not be read from the domain controller, either because the machine is unavailable, or access has been denied. <Indicates that a thread attempted to terminate itself by default (called NtTerminateThread with NULL) and it was the last thread in the current process. Indicates the Sam Server was in the wrong state to perform the desired operation. Indicates the Domain was in the wrong state to perform the desired operation. This operation is only allowed for the Primary Domain Controller of the domain. PThe specified Domain did not exist. TThe specified Domain already exists. An attempt was made to exceed the limit on the number of domains per server for this release. tError status returned when oplock request is denied. Error status returned when an invalid oplock acknowledgment is received by a file system. (This error indicates that the requested operation cannot be completed due to a catastrophic media failure or on-disk data structure corruption. @An internal error occurred. Indicates generic access types were contained in an access mask which should already be mapped to non-generic access types. Indicates a security descriptor is not in the necessary format (absolute or self-relative). XAn access to a user buffer failed at an "expected" point in time. This code is defined since the caller does not want to accept STATUS_ACCESS_VIOLATION in its filter. If an I/O error is returned which is not defined in the standard FsRtl filter, it is converted to the following error which is guaranteed to be in the filter. In this case information is lost, however, the filter correctly handles the exception. If an MM error is returned which is not defined in the standard FsRtl filter, it is converted to one of the following errors which is guaranteed to be in the filter. In this case information is lost, however, the filter correctly handles the exception. If an MM error is returned which is not defined in the standard FsRtl filter, it is converted to one of the following errors which is guaranteed to be in the filter. In this case information is lost, however, the filter correctly handles the exception. If an MM error is returned which is not defined in the standard FsRtl filter, it is converted to one of the following errors which is guaranteed to be in the filter. In this case information is lost, however, the filter correctly handles the exception. The requested action is restricted for use by logon processes only. The calling process has not registered as a logon process. An attempt has been made to start a new session manager or LSA logon session with an ID that is already in use. An invalid parameter was passed to a service or function as the first argument. An invalid parameter was passed to a service or function as the second argument. An invalid parameter was passed to a service or function as the third argument. An invalid parameter was passed to a service or function as the fourth argument. An invalid parameter was passed to a service or function as the fifth argument. An invalid parameter was passed to a service or function as the sixth argument. An invalid parameter was passed to a service or function as the seventh argument. An invalid parameter was passed to a service or function as the eighth argument. An invalid parameter was passed to a service or function as the ninth argument. An invalid parameter was passed to a service or function as the tenth argument. An invalid parameter was passed to a service or function as the eleventh argument. An invalid parameter was passed to a service or function as the twelfth argument. An attempt was made to access a network file, but the network software was not yet started. An attempt was made to start the redirector, but the redirector has already been started. lA new guard page for the stack cannot be created. hA specified authentication package is unknown. A malformed function table was encountered during an unwind operation. Indicates the specified environment variable name was not found in the specified environment block. Indicates that the directory trying to be deleted is not empty. {Corrupt File} The file or directory %hs is corrupt and unreadable. Please run the Chkdsk utility. `A requested opened file is not a directory. The logon session is not in a state that is consistent with the requested operation. hAn internal LSA error has occurred. An authentication package has requested the creation of a Logon Session but the ID of an already existing Logon Session has been specified. |A specified name string is too long for its intended use. XThe user attempted to force close the files on a redirected drive, but there were opened files on the drive, and the user did not specify a sufficient level of force. dThe user attempted to force close the files on a redirected drive, but there were opened directories on the drive, and the user did not specify a sufficient level of force. RtlFindMessage could not locate the requested message ID in the message table resource. An attempt was made to duplicate an object handle into or out of an exiting process. Indicates an invalid value has been provided for the LogonType requested. tIndicates that an attempt was made to assign protection to a file system file or directory and one of the SIDs in the security descriptor could not be translated into a GUID that could be stored by the file system. This causes the protection attempt to fail, which may cause a file creation attempt to fail. Indicates that an attempt has been made to impersonate via a named pipe that has not yet been read from. tIndicates that the specified image is already loaded. <STATUS_ABIOS_NOT_PRESENT @STATUS_ABIOS_LID_NOT_EXIST HSTATUS_ABIOS_LID_ALREADY_OWNED @STATUS_ABIOS_NOT_LID_OWNER DSTATUS_ABIOS_INVALID_COMMAND <STATUS_ABIOS_INVALID_LID PSTATUS_ABIOS_SELECTOR_NOT_AVAILABLE DSTATUS_ABIOS_INVALID_SELECTOR Indicates that an attempt was made to change the size of the LDT for a process that has no LDT. Indicates that an attempt was made to grow an LDT by setting its size, or that the size was not an even number of selectors. Indicates that the starting value for the LDT information was not an integral multiple of the selector size. Indicates that the user supplied an invalid descriptor when trying to set up Ldt descriptors. The specified image file did not have the correct format. It appears to be NE format. PIndicates that the transaction state of a registry sub-tree is incompatible with the requested operation. For example, a request has been made to start a new transaction with one already in progress, or a request has been made to apply a transaction when one is not currently in progress. Indicates an error has occurred during a registry transaction commit. The database has been left in an unknown, but probably inconsistent, state. The state of the registry transaction is left as COMMITTING. An attempt was made to map a file of size zero with the maximum size specified as zero. Too many files are opened on a remote server. This error should only be returned by the Windows redirector on a remote drive. DThe I/O request was canceled. An attempt has been made to remove a file or directory that cannot be deleted. Indicates a name specified as a remote computer name is syntactically invalid. An I/O request other than close was performed on a file after it has been deleted, which can only happen to a request which did not complete before the last handle was closed via NtClose. hIndicates an operation has been attempted on a built-in (special) SAM account which is incompatible with built-in accounts. For example, built-in accounts cannot be deleted. The operation requested may not be performed on the specified group because it is a built-in special group. The operation requested may not be performed on the specified user because it is a built-in special user. Indicates a member cannot be removed from a group because the group is currently the member's primary group. An I/O request other than close and several other special case operations was attempted using a file object that had already been closed. pIndicates a process has too many threads to perform the requested action. For example, assignment of a primary token may only be performed when a process has zero or one threads. An attempt was made to operate on a thread within a specific process, but the thread specified is not in the process specified. TAn attempt was made to establish a token for use as a primary token but the token is already in use. A token can only be the primary token of one process at a time. DPage file quota was exceeded. {Out of Virtual Memory} Your system is low on virtual memory. To ensure that Windows runs properly, increase the size of your virtual memory paging file. For more information, see Help. The specified image file did not have the correct format, it appears to be LE format. The specified image file did not have the correct format, it did not have an initial MZ. The specified image file did not have the correct format, it did not have a proper e_lfarlc in the MZ header. The specified image file did not have the correct format, it appears to be a 16-bit Windows image. The Netlogon service cannot start because another Netlogon service running in the domain conflicts with the specified role. $The time at the Primary Domain Controller is different than the time at the Backup Domain Controller or member server by too large an amount. DThe SAM database on a Windows Server is significantly out of synchronization with the copy on the Domain Controller. A complete synchronization is required. {Unable To Locate DLL} The dynamic link library %hs could not be found in the specified path %hs. The NtCreateFile API failed. This error should never be returned to an application, it is a place holder for the Windows Lan Manager Redirector to use in its internal error mapping routines. {Privilege Failed} The I/O permissions for the process could not be changed. {Ordinal Not Found} The ordinal %ld could not be located in the dynamic link library %hs. {Entry Point Not Found} The procedure entry point %hs could not be located in the dynamic link library %hs. {Application Exit by CTRL+C} The application terminated as a result of a CTRL+C. 0{Virtual Circuit Closed} The network transport on your computer has closed a network connection. There may or may not be I/O requests outstanding. 8{Virtual Circuit Closed} The network transport on a remote computer has closed a network connection. There may or may not be I/O requests outstanding. {Insufficient Resources on Remote Computer} The remote computer has insufficient resources to complete the network request. For instance, there may not be enough memory available on the remote computer to carry out the request at this time. {Virtual Circuit Closed} An existing connection (virtual circuit) has been broken at the remote computer. There is probably something wrong with the network software protocol or the network hardware on the remote computer. \{Virtual Circuit Closed} The network transport on your computer has closed a network connection because it had to wait too long for a response from the remote computer. |The connection handle given to the transport was invalid. xThe address handle given to the transport was invalid. {DLL Initialization Failed} Initialization of the dynamic link library %hs failed. The process is terminating abnormally. {Missing System File} The required system file %hs is bad or missing. {Application Error} The exception %s (0x%08lx) occurred in the application at location 0x%08lx. {Application Error} The application failed to initialize properly (0x%lx). Click on OK to terminate the application. {Unable to Create Paging File} The creation of the paging file %hs failed (%lx). The requested size was %ld. {No Paging File Specified} No paging file was specified in the system configuration. {Incorrect System Call Level} An invalid level was passed into the specified system call. {Incorrect Password to LAN Manager Server} You specified an incorrect password to a LAN Manager 2.x or MS-NET server. {EXCEPTION} A real-mode application issued a floating-point instruction and floating-point hardware is not present. The pipe operation has failed because the other end of the pipe has been closed. {The Registry Is Corrupt} The structure of one of the files that contains Registry data is corrupt, or the image of the file in memory is corrupt, or the file could not be recovered because the alternate copy or log was absent or corrupt. An I/O operation initiated by the Registry failed unrecoverably. The Registry could not read in, or write out, or flush, one of the files that contain the system's image of the Registry. \An event pair synchronization operation was performed using the thread specific client/server event pair object, but no event pair object was associated with the thread. DThe volume does not contain a recognized file system. Please make sure that all required file system drivers are loaded and that the volume is not corrupt. No serial device was successfully initialized. The serial driver will unload. \The specified local group does not exist. The specified account name is not a member of the local group. The specified account name is already a member of the local group. \The specified local group already exists. A requested type of logon (e.g., Interactive, Network, Service) is not granted by the target system's local security policy. Please ask the system administrator to grant the necessary form of logon. The maximum number of secrets that may be stored in a single system has been exceeded. The length and number of secrets is limited to satisfy United States State Department export restrictions. TThe length of a secret exceeds the maximum length allowed. The length and number of secrets is limited to satisfy United States State Department export restrictions. The Local Security Authority (LSA) database contains an internal inconsistency. The requested operation cannot be performed in fullscreen mode. During a logon attempt, the user's security context accumulated too many security IDs. This is a very unusual situation. Remove the user from some global or local groups to reduce the number of security ids to incorporate into the security context. tA user has requested a type of logon (e.g., interactive or network) that has not been granted. An administrator has control over who may logon interactively and through the network. The system has attempted to load or restore a file into the registry, and the specified file is not in the format of a registry file. (An attempt was made to change a user password in the security account manager without providing the necessary Windows cross-encrypted password. lA Windows Server has an incorrect configuration. pAn attempt was made to explicitly access the secondary copy of information via a device control to the Fault Tolerance driver and the secondary copy is not present in the system. A configuration registry node representing a driver service entry was ill-formed and did not contain required value entries. An illegal character was encountered. For a multi-byte character set this includes a lead byte without a succeeding trail byte. For the Unicode character set this includes the characters 0xFFFF and 0xFFFE. No mapping for the Unicode character exists in the target multi-byte code page. The Unicode character is not defined in the Unicode character set installed on the system. xThe paging file cannot be created on a floppy diskette. {Floppy Disk Error} While accessing a floppy disk, an ID address mark was not found. d{Floppy Disk Error} While accessing a floppy disk, the track address from the sector ID field was found to be different than the track address maintained by the controller. {Floppy Disk Error} The floppy disk controller reported an error that is not recognized by the floppy disk driver. {Floppy Disk Error} While accessing a floppy-disk, the controller returned inconsistent results via its registers. {Hard Disk Error} While accessing the hard disk, a recalibrate operation failed, even after retries. {Hard Disk Error} While accessing the hard disk, a disk operation failed even after retries. {Hard Disk Error} While accessing the hard disk, a disk controller reset was needed, but even that failed. TAn attempt was made to open a device that was sharing an IRQ with other devices. At least one other device that uses that IRQ was already opened. Two concurrent opens of devices that share an IRQ and only work via interrupts is not supported for the particular bus type that the devices use. {FT Orphaning} A disk that is part of a fault-tolerant volume can no longer be accessed. The system bios failed to connect a system interrupt to the device or bus for which the device is connected. HTape could not be partitioned. When accessing a new tape of a multivolume partition, the current blocksize is incorrect. Tape partition information could not be found when loading a tape. lAttempt to lock the eject media mechanism fails. 0Unload media fails. PPhysical end of tape was detected. {No Media} There is no media in the drive. Please insert media into drive %hs. A member could not be added to or removed from the local group because the member does not exist. A new member could not be added to a local group because the member has the wrong account type. Illegal operation attempted on a registry key which has been marked for deletion. System could not allocate required space in a registry log. PToo many Sids have been specified. An attempt was made to change a user password in the security account manager without providing the necessary LM cross-encrypted password. An attempt was made to create a symbolic link in a registry key that already has subkeys or values. An attempt was made to create a Stable subkey under a Volatile parent key. The I/O device is configured incorrectly or the configuration parameters to the driver are incorrect. An error was detected between two drivers or within an I/O driver. The device is not in a valid state to perform this request. TThe I/O device reported an I/O error. A protocol error was detected between the driver and the device. This operation is only allowed for the Primary Domain Controller of the domain. |Log file space is insufficient to support this operation. A write operation was attempted to a volume after it was dismounted. The workstation does not have a trust secret for the primary domain in the local LSA database. The SAM database on the Windows Server does not have a computer account for this workstation trust relationship. The logon request failed because the trust relationship between the primary domain and the trusted domain failed. The logon request failed because the trust relationship between this workstation and the primary domain failed. LThe Eventlog log file is corrupt. No Eventlog log file could be opened. The Eventlog service did not start. The network logon failed. This may be because the validation authority can't be reached. An attempt was made to acquire a mutant such that its maximum count would have been exceeded. An attempt was made to logon, but the netlogon service was not started. HThe user's account has expired. \{EXCEPTION} Possible deadlock condition. The credentials supplied conflict with an existing set of credentials. An attempt was made to establish a session to a network server, but there are already too many sessions established to that server. XThe log file has changed between reads. The account used is an Interdomain Trust account. Use your global user account or local user account to access this server. The account used is a Computer Account. Use your global user account or local user account to access this server. The account used is an Server Trust account. Use your global user account or local user account to access this server. The name or SID of the domain specified is inconsistent with the trust information for that domain. A volume has been accessed for which a file system driver is required that has not yet been loaded. There is no user session key for the specified logon session. \The remote user session has been deleted. Indicates the specified resource language ID cannot be found in the image file. Insufficient server resources exist to complete the request. The size of the buffer is invalid for the specified operation. The transport rejected the network address specified as invalid. The transport rejected the network address specified due to an invalid use of a wildcard. The transport address could not be opened because all the available addresses are in use. The transport address could not be opened because it already exists. TThe transport address is now closed. dThe transport connection is now disconnected. \The transport connection has been reset. |The transport cannot dynamically acquire any more nodes. dThe transport aborted a pending transaction. |The transport timed out a request waiting for a response. The transport did not receive a release for a pending response. The transport did not find a transaction matching the specific token. The transport had previously responded to a transaction request. The transport does not recognized the transaction request identifier specified. The transport does not recognize the transaction request type specified. The transport can only process the specified request on the server side of a session. The transport can only process the specified request on the client side of a session. {Registry File Failure} The registry cannot load the hive (file): %hs or its log or alternate. It is corrupt, absent, or not writable. {Unexpected Failure in DebugActiveProcess} An unexpected failure occurred while processing a DebugActiveProcess API request. You may choose OK to terminate the process, or Cancel to ignore the error. ({Fatal System Error} The %hs system process terminated unexpectedly with a status of 0x%08x (0x%08x 0x%08x). The system has been shut down. {Data Not Accepted} The TDI client could not handle the data received during an indication. {Unable to Retrieve Browser Server List} The list of servers for this workgroup is not currently available. HNTVDM encountered a hard error. {Cancel Timeout} The driver %hs failed to complete a cancelled I/O request in the allotted time. P{Reply Message Mismatch} An attempt was made to reply to an LPC message, but the thread specified by the client ID in the message was not waiting on that message. {Mapped View Alignment Incorrect} An attempt was made to map a view of a file, but either the specified base address or the offset into the file were not aligned on the proper allocation granularity. {Bad Image Checksum} The image %hs is possibly corrupt. The header checksum does not match the computed checksum. {Delayed Write Failed} Windows was unable to save all the data for the file %hs. The data has been lost. This error may be caused by a failure of your computer hardware or network connection. Please try to save this file elsewhere. @The parameter(s) passed to the server in the client/server shared memory window were invalid. Too much data may have been put in the shared memory window. The user's password must be changed before logging on the first time. <The object was not found. LThe stream is not a tiny stream. DA transaction recover failed. xThe request must be handled by the stack overflow code. @A consistency check failed. The attempt to insert the ID in the index failed because the ID is already in the index. The attempt to set the object's ID failed because the object already has an ID. Internal OFS status codes indicating how an allocation operation is handled. Either it is retried after the containing onode is moved or the extent stream is converted to a large stream. LThe request needs to be retried. $The attempt to find the object found an object matching by ID on the volume but it is out of the scope of the handle used for the operation. The bucket array must be grown. Retry transaction after doing so. |The property set specified does not exist on the object. pThe user/kernel marshalling buffer has overflowed. tThe supplied variant structure contains invalid data. pCould not find a domain controller for this domain. The user account has been automatically locked because too many invalid logon attempts or password change attempts have been requested. NtClose was called on a handle that was protected from close via NtSetInformationObject. The transport connection attempt was refused by the remote system. hThe transport connection was gracefully closed. The transport endpoint already has an address associated with it. An address has not yet been associated with the transport endpoint. An operation was attempted on a nonexistent transport connection. An invalid operation was attempted on an active transport connection. tThe remote network is not reachable by the transport. tThe remote system is not reachable by the transport. The remote system does not support the transport protocol. No service is operating at the destination port of the transport on the remote system. <The request was aborted. |The transport connection was aborted by the local system. hThe specified buffer contains ill-formed data. The requested operation cannot be performed on a file with a user mapped section open. {Audit Failed} An attempt to generate a security audit failed. The timer resolution was not previously set by the current process. A connection to the server could not be made because the limit on the number of concurrent connections for this account has been reached. Attempting to login during an unauthorized time of day for this account. |The account is not authorized to login from this station. h{UP/MP Image Mismatch} The image %hs has been modified for use on a uniprocessor system, but you are running it on a multiprocessor machine. Please reinstall the image file. |There is insufficient account information to log you on. {Invalid DLL Entrypoint} The dynamic link library %hs is not written correctly. The stack pointer has been left in an inconsistent state. The entrypoint should be declared as WINAPI or STDCALL. Select YES to fail the DLL load. Select NO to continue execution. Selecting NO may cause the application to operate incorrectly. {Invalid Service Callback Entrypoint} The %hs service is not written correctly. The stack pointer has been left in an inconsistent state. The callback entrypoint should be declared as WINAPI or STDCALL. Selecting OK will cause the service to continue operation. However, the service process may operate incorrectly. The server received the messages but did not send a reply. The system has detected an IP address conflict with another system on the network. The local interface has been disabled. More details are available in the system event log. Consult your network administrator to resolve the conflict. ,The system has detected an IP address conflict with another system on the network. Network operations on this system may be disrupted as a result. More details are available in the system event log. Consult your network administrator immediately to resolve the conflict. d{Low On Registry Space} Your maximum registry size is too small. To ensure that Windows runs properly, increase your maximum registry size. For more information, see Help. The contacted server does not support the indicated part of the DFS namespace. A callback return system service cannot be executed when no callback is active. The service being accessed is licensed for a particular number of connections. No more connections can be made to the service at this time because there are already as many connections as the service can accept. The password provided is too short to meet the policy of your user account. Please choose a longer password. The policy of your user account does not allow you to change passwords too frequently. This is done to prevent users from changing back to a familiar, but potentially discovered, password. If you feel your password has been compromised then please contact your administrator immediately to have a new one assigned. You have attempted to change your password to one that you have used in the past. The policy of your user account does not allow this. Please select a password that you have not previously used. You have attempted to load a legacy device driver while its device instance had been disabled. lThe specified compression format is unsupported. |The specified hardware profile configuration is invalid. The specified Plug and Play registry device path is invalid. {Driver Entry Point Not Found} The %hs device driver could not locate the ordinal %ld in driver %hs. {Driver Entry Point Not Found} The %hs device driver could not locate the entry point %hs in driver %hs. {Application Error} The application attempted to release a resource it did not own. Click on OK to terminate the application. An attempt was made to create more links on a file than the file system supports. The specified quota list is internally inconsistent with its descriptor. |The specified file has been relocated to offline storage. ({Windows Evaluation Notification} The evaluation period for this installation of Windows has expired. This system will shutdown in 1 hour. To restore access to this installation of Windows, please upgrade this installation using a licensed distribution of this product. D{Illegal System DLL Relocation} The system DLL %hs was relocated in memory. The application will not run properly. The relocation occurred because the DLL %hs occupied an address range reserved for Windows system DLLs. The vendor supplying the DLL should be contacted for a new DLL. t{License Violation} The system has detected tampering with your registered product type. This is a violation of your software license. Tampering with product type is not permitted. {DLL Initialization Failed} The application failed to initialize because the window station is shutting down. {Unable to Load Device Driver} %hs device driver could not be loaded. Error Status was 0x%x `DFS is unavailable on the contacted server. An operation was attempted to a volume after it was dismounted. An internal error occurred in the Win32 x86 emulation subsystem. |Win32 x86 emulation subsystem Floating-point stack check. The validation process needs to continue on to the next step. xThere was no match for the specified key in the index. There are no more matches for the current index enumeration. pThe NTFS file or directory is not a reparse point. The Windows I/O reparse tag passed for the NTFS reparse point is invalid. The Windows I/O reparse tag does not match the one present in the NTFS reparse point. The user data passed for the NTFS reparse point is invalid. The layered file system driver for this IO tag did not handle it when needed. The NTFS symbolic link could not be resolved even though the initial file name is valid. XThe NTFS directory is a reparse point. The range could not be added to the range list because of a conflict. The specified medium changer source element contains no media. The specified medium changer destination element already contains media. tThe specified medium changer element does not exist. The specified element is contained within a magazine that is no longer present. The device requires reinitialization due to hardware errors. PThe file encryption attempt failed. PThe file decryption attempt failed. |The specified range could not be found in the range list. There is no encryption recovery policy configured for this system. The required encryption driver is not loaded for this system. The file was encrypted with a different encryption driver than is currently loaded. `There are no EFS keys defined for the user. TThe specified file is not encrypted. The specified file is not in the defined EFS export format. The specified file is encrypted and the user does not have the ability to decrypt it. The guid passed was not recognized as valid by a WMI data provider. The instance name passed was not recognized as valid by a WMI data provider. The data item id passed was not recognized as valid by a WMI data provider. The WMI request could not be completed and should be retried. The policy object is shared and can only be modified at the root hThe policy object does not exist when it should tThe requested policy information only lives in the Ds pThe volume must be upgraded to enable this feature The remote storage service is not operational at this time. tThe remote storage service encountered a media error. pThe tracking (workstation) service is not running. The server process is running under a SID different than that required by client. The specified directory service attribute or value does not exist. The attribute syntax specified to the directory service is invalid. The attribute type specified to the directory service is not defined. The specified directory service attribute or value already exists. HThe directory service is busy. XThe directory service is not available. The directory service was unable to allocate a relative identifier. The directory service has exhausted the pool of relative identifiers. The requested operation could not be performed because the directory service is not the master for that type of operation. The directory service was unable to initialize the subsystem that allocates relative identifiers. The requested operation did not satisfy one or more constraints associated with the class of the object. The directory service can perform the requested operation only on a leaf object. The directory service cannot perform the requested operation on the Relatively Defined Name (RDN) attribute of an object. The directory service detected an attempt to modify the object class of an object. An error occurred while performing a cross domain move operation. dUnable to Contact the Global Catalog Server. The requested operation requires a directory service, and none was available. The reparse attribute cannot be set as it is incompatible with an existing attribute. tA group marked use for deny only can not be enabled. d{EXCEPTION} Multiple floating point faults. `{EXCEPTION} Multiple floating point traps. DThe device has been removed. `The volume change journal is being deleted. lThe volume change journal service is not active. \The requested interface is not supported. tA directory service resource limit has been exceeded. {System Standby Failed} The driver %hs does not support standby mode. Updating this driver may allow the system to go to standby mode. Mutual Authentication failed. The server's password is out of date at the domain controller. The system file %1 has become corrupt and has been replaced. {EXCEPTION} Alignment Error A datatype misalignment error was detected in a load or store instruction. dThe WMI data item or data block is read only. tThe WMI data item or data block could not be changed. {Virtual Memory Minimum Too Low} Your system is low on virtual memory. Windows is increasing the size of your virtual memory paging file. During this process, memory requests for some applications may be denied. For more information, see Help. {EXCEPTION} Register NaT consumption faults. A NaT value is consumed on a non speculative instruction. The medium changer's transport element contains media, which is causing the operation to fail. Security Accounts Manager initialization failed because of the following error: %hs Error Status: 0x%x. Please click OK to shutdown this system and reboot into Directory Services Restore Mode, check the event log for more detailed information. This operation is supported only when you are connected to the server. Only an administrator can modify the membership list of an administrative group. xA device was removed so enumeration must be restarted. tThe journal entry has been deleted from the journal. Cannot change the primary group ID of a domain controller account. 0{Fatal System Error} The system image %s is not properly signed. The file has been replaced with the signed file. The system has been shut down. XDevice will not start without a reboot. xCurrent device power state cannot support this request. TThe specified group type is invalid. In mixed domain no nesting of global group if group is security enabled. In mixed domain, cannot nest local groups with other local groups, if the group is security enabled. tA global group cannot have a local group as a member. |A global group cannot have a universal group as a member. |A universal group cannot have a local group as a member. lA global group cannot have a cross domain member. A local group cannot have another cross domain local group as a member. Can not change to security disabled group because of having primary members in this group. The WMI operation is not supported by the data block or method. There is not enough power to complete the requested operation. |Security Account Manager needs to get the boot password. Security Account Manager needs to get the boot key from floppy disk. LDirectory Service can not start. Directory Services could not start because of the following error: %hs Error Status: 0x%x. Please click OK to shutdown this system and reboot into Directory Services Restore Mode, check the event log for more detailed information. Security Accounts Manager initialization failed because of the following error: %hs Error Status: 0x%x. Please click OK to shutdown this system and reboot into Safe Mode, check the event log for more detailed information. The requested operation can be performed only on a global catalog server. A local group can only be a member of other local groups in the same domain. Foreign security principals cannot be members of universal groups. Your computer could not be joined to the domain. You have exceeded the maximum number of computer accounts you are allowed to create in this domain. Contact your system administrator to have this limit reset or increased. HSTATUS_MULTIPLE_FAULT_VIOLATION This operation is not supported on a Microsoft Small Business Server 4WOW Assertion Error. \Debugger did not perform a state change. hDebugger has found the application is not idle. HThe string binding is invalid. `The binding handle is not the correct type. HThe binding handle is invalid. `The RPC protocol sequence is not supported. TThe RPC protocol sequence is invalid. @The string UUID is invalid. HThe endpoint format is invalid. HThe network address is invalid. 8No endpoint was found. DThe timeout value is invalid. HThe object UUID was not found. dThe object UUID has already been registered. `The type UUID has already been registered. TThe RPC server is already listening. `No protocol sequences have been registered. LThe RPC server is not listening. DThe manager type is unknown. <The interface is unknown. 8There are no bindings. LThere are no protocol sequences. HThe endpoint cannot be created. Not enough resources are available to complete this operation. HThe RPC server is unavailable. xThe RPC server is too busy to complete this operation. LThe network options are invalid. There are no remote procedure calls active on this thread. LThe remote procedure call failed. tThe remote procedure call failed and did not execute. HAn RPC protocol error occurred. xThe transfer syntax is not supported by the RPC server. HThe type UUID is not supported. 0The tag is invalid. DThe array bounds are invalid. `The binding does not contain an entry name. @The name syntax is invalid. LThe name syntax is not supported. No network address is available to use to construct a UUID. DThe endpoint is a duplicate. PThe authentication type is unknown. \The maximum number of calls is too small. 8The string is too long. \The RPC protocol sequence was not found. TThe procedure number is out of range. The binding does not contain any authentication information. XThe authentication service is unknown. TThe authentication level is unknown. LThe security context is invalid. TThe authorization service is unknown. 4The entry is invalid. PThe operation cannot be performed. There are no more endpoints available from the endpoint mapper. LNo interfaces have been exported. DThe entry name is incomplete. HThe version option is invalid. @There are no more members. DThere is nothing to unexport. DThe interface was not found. <The entry already exists. 8The entry is not found. LThe name service is unavailable. XThe network address family is invalid. \The requested operation is not supported. |No security context is available to allow impersonation. PAn internal error occurred in RPC. pThe RPC server attempted an integer divide by zero. hAn addressing error occurred in the RPC server. A floating point operation at the RPC server caused a divide by zero. xA floating point underflow occurred at the RPC server. tA floating point overflow occurred at the RPC server. A remote procedure call is already in progress for this thread. @There are no more bindings. HThe group member was not found. |The endpoint mapper database entry could not be created. LThe object UUID is the nil UUID. PNo interfaces have been registered. \The remote procedure call was cancelled. The binding handle does not contain all required information. A communications failure occurred during a remote procedure call. tThe requested authentication level is not supported. DNo principal name registered. The error specified is not a valid Windows RPC error code. `A security package specific error occurred. <Thread is not cancelled. pInvalid asynchronous remote procedure call handle. |Invalid asynchronous RPC call handle for this operation. The list of RPC servers available for auto-handle binding has been exhausted. |The file designated by DCERPCCHARTRANS cannot be opened. The file containing the character translation table has fewer than 512 bytes. tA null context handle is passed as an [in] parameter. The context handle does not match any known context handles. \The context handle changed during a call. The binding handles passed to a remote procedure call do not match. `The stub is unable to get the call handle. lA null reference pointer was passed to the stub. XThe enumeration value is out of range. DThe byte count is too small. @The stub received bad data. pInvalid operation on the encoding/decoding handle. lIncompatible version of the serializing package. TIncompatible version of the RPC stub. dThe RPC pipe object is invalid or corrupted. |An invalid operation was attempted on an RPC pipe object. DUnsupported RPC pipe version. dThe RPC pipe object has already been closed. xThe RPC call completed before all pipes were processed. dNo more data is available from the RPC pipe. A device is missing in the system BIOS MPS table. This device will not be used. Please contact your system vendor for system BIOS update. `A translator failed to translate resources. hA IRQ translator failed to translate resources. @Session name %1 is invalid. PThe protocol driver %1 is invalid. |The protocol driver %1 was not found in the system path. |A close operation is pending on the Terminal Connection. `There are no free output buffers available. LThe MODEM.INF file was not found. `The modem (%1) was not found in MODEM.INF. The modem did not accept the command sent to it. Verify the configured modem name matches the attached modem. The modem did not respond to the command sent to it. Verify the modem is properly cabled and powered on. Carrier detect has failed or carrier has been dropped due to disconnect. Dial tone not detected within required time. Verify phone cable is properly attached and functional. lBusy signal detected at remote site on callback. `Voice detected at remote site on callback. 8Transport driver error The client you are using is not licensed to use this system. Your logon request is denied. The system has reached its licensed logon limit. Please try again later. The system license has expired. Your logon request is denied. XThe specified session cannot be found. dThe specified session name is already in use. @The requested operation cannot be completed because the Terminal Connection is currently busy processing a connect, disconnect, reset, or delete operation. An attempt has been made to connect to a session whose video mode is not supported by the current client. The application attempted to enable DOS graphics mode. DOS graphics mode is not supported. HThe requested operation can be performed only on the system console. This is most often the result of a driver or system DLL requiring direct console access. The client failed to respond to the server connect message. pDisconnecting the console session is not supported. Reconnecting a disconnected session to the console is not supported. The request to control another session remotely was denied. A process has requested access to a session, but has not been granted those access rights. dThe Terminal Connection driver %1 is invalid. The Terminal Connection driver %1 was not found in the system path. |The requested session cannot be controlled remotely. This may be because the session is disconnected or does not currently have a user logged on. Also, you cannot control a session remotely from the system console or control the system console remotely. And you cannot remote control your own current session. The requested session is not configured to allow remote control. The RDP protocol component %2 detected an error in the protocol stream and has disconnected the client. Your request to connect to this Terminal server has been rejected. Your Terminal Server Client license number has not been entered for this copy of the Terminal Client. Please call your system administrator for help in entering a valid, unique license number for this Terminal Server Client. Click OK to continue. dYour request to connect to this Terminal server has been rejected. Your Terminal Server Client license number is currently being used by another user. Please call your system administrator to obtain a new copy of the Terminal Server Client with a valid, unique license number. Click OK to continue. lAn attempt was made to run an invalid AML opcode \The AML Interpreter Stack has overflowed PAn inconsistent state has occurred An attempt was made to access an array outside of its bounds TA required argument was not specified @A fatal error has occurred PAn invalid SuperName was specified lAn argument with an incorrect type was specified hAn object with an incorrect type was specified dA target with an incorrect type was specified hAn incorrect number of arguments were specified HAn address failed to translate TAn incorrect event type was specified XA handler for the target already exists \Invalid data for the target was specified hAn invalid region for the target was specified An attempt was made to access a field outside of the defined range dThe Global system lock could not be acquired xAn attempt was made to reinitialize the ACPI subsystem `The ACPI subsystem has not been initialized LAn incorrect mutex was specified LThe mutex is not currently owned An attempt was made to access the mutex by a process that was not the owner pAn error occurred during an access to Region Space dAn attempt was made to use an incorrect table \The registration of an ACPI event failed hAn ACPI Power Object failed to transition state 4-5?6G6]6666(7>7^7d7777788<8B8e8{8888888899(9T9m9r9x99999::/:E:J:e:j:r:x:~::::::::; ;D;r;;p=v==O> ??'?B?V?[?`?s?x?}?????? \0000!0,07055666 77777788849899999+:<:H:O:Z:`::::::::';X>0000000000012'2C22a333344[4445'5+5/53575;5?5C5G5K5O5S5W5[5_5c555555 6~6;7\7M8c8899<<=>K?S?@P,0100 112 2P2t24 4,4T456{66L7;}< = =%====z?????????P0W0]0b000011111122 22222-2O264Z444465D5H5X5o5|555556I6N6677'8-8=8E8l99995:T:h::0;5;;;<4A>g>>k??`60B0I0Q0V0[0c02304b4455=5}555D6666"777788888"8&8*8D899/979F9X9x999:: :':M:R:v::::::::;;~<<<<=P=???ph11122$233445u66x7}77777778y888m9999999p;x;|;;;P>X>\>d>h>!?E?L?l??l'0,00091C1N1T1Y1_1w1}1222223 3=3444E555 66"6,6=6E6d666:::;<<=|=======?l"1*11223 3E3`3e3334444556(6:6w6{66666668L8Q8889999999;}<r>|33333333333 4444)5N5(68s88]9:;<;e;w;>>>>>>>>>>>>>>>>>>>>>>>>>>>>??? ?????m??h00u1338333444F5z555588999:M:c: ;$;(;,;0;4;8;<;@;D;H;L;P;T;X;\;8<<=>>o?t??0 111T1[1h1111L2P22%3*3b3333 4#484>4D455y6666H778A8:;I;i;;;;;<==2=L=E>L>P>T>X>\>`>d>h>p>q????D0H0L0P0T0X0\0`0d0h0l0p0t0x0|00001T1X1u1M223 333:3?3\6`67C8H8]8o8888::D;H;`;e;;$<~<<<=@=D=H=L=.????00B0m00001D1o11112F2n2222222222233 33333F3]3333/44444456889:;9=D=O====F>?g??M0}000113K3[3K4>5C5555555@6L6 787f88899Y9z999:2:8:::::::;,;<;;;;;;==(>T>f>B?F?J?N?R?V?Z?^?b?f?j?n?r?v?z?~???X03 3$3f3G4S4X4`4e4j4r4446881999:B>>>? ?M?|???0-01111111111111111222 22222 2$2(2,2024282<23Z355/57555?66667 77(7.7T76::::;;; ;;;;/;i;;;;+<9+>a>k>r>z>~>>>>Z? E0Q0X001122222n3444444445Y66666 8J8888 99*:;:H:Y:::;;;;;;;;;;<="=S=d=l=t=|============> >>">1>6>_>0Lx13334.43444l555667F7\7777899::<<=>g?~???@40-111222<3334 4_44445G66:p>>P0F0;1@11111Y2d9;;<>>>>:???`1113?4445!5q55555555555555555568666*7/777b88896:;::::::; ;;.;;;L;};;;;@ >;>Y>r>>>1?7?=?C?O?]?h?s?p(0M000000000091W111111111234+4U5#6L6R6666"78829;9D999.:3:H:l:::g<<<< ==,=6=Q=V====4>8>>112233(34383H3X3d3h3p3t3x3|333333333333333333333333333333333444 44444 4$4(4,4044484<4@4D4H4L4P4T4X4\4`4d4h4l4x44444444444444455 56666666666677(787D7H7P7T7\7`7l7p7|777777777777777778 888$8,848<8D8L8T8\8d8l8t8|8::::::;;; ;(;,;8;@;D;P;X;\;h;p;t;;;;;;;;;;;;;;;;;;>>>>0O0U0000C1Y1h1m1y11111 2222*345585O5f5555>6U6h6u6:7K7T758L8g888888/:<:N::8;T;^;<<'>D>]>>> ?3????`'090w00S77.949E9{99999999::?:J::u;;X>c>h>t>>>>????pA0a00025223$3c3h3m3t3z33333333E4n45:?:H:::::;;; <1<=<)=5=====">)>2>>>>?'?X50P0b000001g2222222B3U3q333q5v556o88 99:E;s;d<>>>>{????000019182G2V2e2334^449::B?G?$2]789::,;L;2<==??D$00060_01816677"7+7c7n7v7770858X8888g9l99l=t==0111Q222233'3/3B3r333333333333445%59555!6H6 8D8_888888888 99Q9c9999999<7<<<<=6=q===>M>>>>)?`???090n000 1=1p111 2<2o222383|3333J4Q44455y5556E6x6667D7t777.848]88899>9e99;";&;*;.;2;6;:;>;B;F;J;N;R;V;Z;^;;<<<<<<<<<<<<<<==]= `01*1^1111.2b222223f33344-5155595=5A5E5I5M5Q5U5Y5]5a5e5i5s55778889:0555588@ #3u<P D0J0X0#1)15134D77Q8 ;`035;<>>?pT 023b334d44445k55.8999:/:C:b::<9=C=i=s===R>>>>>????;0B00122222222,4D4r444445(5I555v66L779)9<9]9::9;V;o;z;;;&<7D>a>g>>>>>>P??000011(1_1d11111111 22)2/292?2Y2q2w222222O3r3w333333333p4}4444566789&9C9[99:4:@:m::::::;;2;;;;:]>e>v>}>>>>>>>/?5?>?N???800191>1C1H1a1x1111/44447b8g8a99A;V;<<D 1D1]112556778#838m8t8~889"9>9d999::::{==c>{>,00212333>5c5h588 9Z9j9o9??@00:1O1s22334Q5555555 688:99: :>>,?B??x5555;;>>8e011p2(44444455@5g5v5/6778G88889981111126(7i7n7788888889999":xl1y15Q5e55F6Q6a6o677777777777778>8F8V8^8|8888b::::::;O;a;w;;;;;;;;B>>6??@`:0?001112l222N344t45 5V52676n6G7L77L8Q8w8@9T9A=V=====>->G>Y>v>>>>>>PD2234-444#5<5a5~555556646E6b6o6666 88M->J>o>>F?T?f?q????p 00011111 222F234444 4$4M4p44444444444555 5l5u5555555566 6$6(6,60646866666667777778W8i8888=9>I>[>f>>>>\000&22222222 33%3C3R3]3333333,456267?7G9:::9;;;< =I===h1111111122722|3333344y555667789'9C9P999:U::;<==w>>>(????Lo0O1x1|2<3x33788H9q99:::!;F;;;<0J>>>>,?e???0G00001@lO0l0222222222222222222222222222333 33333 3$3(3,3034383<3@3D3H3L3P3T3X3\3`3d3h3l3p3t3x3|333333333333333333333333333333333444 44444 4$4(4,4044484<4@4D4H4L4P4T4X4\4`4d4h4l4p4t4x4|444444444444444444444444444444444555 55555 5$5(5,5054585<5@5D5H5L5P5T5X5\5`5d5h5l5p5t5x5|55555555555555555555556 666 6&6,62686>6D6J6P6V6^6u6z66666666667 777!7'7-727877W8d8979@9999993:8:=:Y:`:g:l:::<<<<<<<<<<<<<<<<<< >'>K> ?$?(?,?0?4?8?(>D>>>>>>>>>>>>>>>>>> ? 0e2j226q7v78G>>>>>>>>>>?????? ?$?0?4?8?=_=_=_d|>_=__W<_=_?_Rich=_PELE7  F XHX(0 6p`.text `.dataT @.rsrc 608@B.relocpN@B0[8ntdll.dllw#w#wwSwwK0wxw9Aww$qww*ww_w+www w|w+.wwww'{wLww&wwwwwkww1w8RwBw[w٢wGswwkww,wE7RE7SE7 TE7\\Device\SetupUSV3h$(XHSS5XHSSSSSSEjP]]]]]E]]]]]E;h,(XHSSSSSSSjEjP;}5$(XHXHjhPXH5$(XH;|WhjP XH;|9@(XHjVXH;|'SPjVXH;|S5,(XHVXXH;}5$(XH5XH5,(XH2  XH^[U(S] V3tttuEP(XHEjEEeeejPEPE VPEE@$XH|uSu  XHu XH^[ = XHVWu B|-@(XH$ XHWjV?}WjV2| WjV%_^U,V5$ XHEh( XHP(XHEj E܍EeeejPEPEVPEE@$XH| uXH^UEh( XHP(XHEPEPjj"|,EWPjju| U$ XHu_U|VW5( XH=(XHE3Pfufu5$ XHEP׍Eh XHPVVVEVPEPEPEVPEPPXH;Ep EPVVVVVVEuEDj@PLXHuHXH;|f}t{WuDXHVVu@XH4Vu<XHVVu@XHVEjPVu8XH;|Eȣ, XHu5XHu֋_^U$VE5( XHP(XH$ XHeEEeEEEPEh?PE@XH|uTXHuXH^à, XHjh( XHPjhh0 XH5$ XH\XHU$ XHE( XHEEPEPEPj`XHjdXHQQ3= XH$ XH3Q$QQ QPD$PQQQRhXHYYQQ3 $ XHPPPPT$h RPPPQhXHYYUQQEh4 XHP(XHjh, XHEh$ XHPlXHV( XHVtXHY E* XHj $ XHQ+QVpXH^%?jj5 XH@XH XH w[$*XH?RK4D=6/(!A! F j XH5((XHxXH|b3%XHXHXHXHXHXHXHXHXHXHXHXHXHXHUpSVEW3=XHPVj[Sj׍EPVSj׍EPVSj׍EPVSj SXH;VEj,PVXH;=XHVSVSh XH;VjVSh((XH׋=XH;Eh$XHP(XHVVEj jEjVEVPEPEhPEuE@u܉uXH;|nEVPVhXHVVVVVjXH;|MEPhbXHXH9ut9 XHVE((XHEVEjtE ~@F @3ɉCH;}tf9tf@@fu39ut*uuuuPjDXHjX_0^[%XH`$.DRjz4Rpl "6L\lgRtlSetOwnerSecurityDescriptorbRtlSetDaclSecurityDescriptorRtlCreateSecurityDescriptor8RtlAddAccessAllowedAceyRtlCreateAclRtlFreeSidHRtlAllocateAndInitializeSidLNtClose NtSetSecurityObjectNtOpenFileRtlInitUnicodeString.LdrUnloadDll$LdrGetProcedureAddress'LdrLoadDllNtQueryInformationProcessNtResumeThread%NtWaitForSingleObjectNtTerminateProcessRtlDestroyProcessParametersRtlCreateUserProcessRtlCreateProcessParameterskNtDeleteKeyNtOpenKeyNtQueryDirectoryObjectzNtFlushVirtualMemoryNtShutdownSystem~NtFsControlFile\NtCreatePagingFileRtlGetFullPathName_UwcslenNtSetEventnNtDeviceIoControlFile9RtlPcToFileHeaderRtlCreateUserThreadUNtCreateFileSNtCreateEventNtQuerySystemInformationNtInitializeRegistryGRtlAdjustPrivilegentdll.dll DbgBreakPointJRtlAllocateHeapRtlUnicodeStringToAnsiString0RtlNormalizeProcessParams 8Ph  01pb(##`####t## ##5##?##F##dI## x%$%'=',?'?'L'_'a'g'i'q'**4..4//D/R/////d////// 0 0Xq0000<::+RRp/$SP_MSG_FIRST l%%IWelcome to Setup. This portion of the Setup program prepares Microsoft(R) Windows 2000(TM) to run on your computer.  To set up Windows 2000 now, press ENTER.  To repair a Windows 2000 installation, press R.  To quit Setup without installing Windows 2000, press F3. <The following list shows the existing partitions and unpartitioned space on this computer. Use the UP and DOWN ARROW keys to select an item in the list.  To create a partition in the unpartitioned space, press C.  To delete the selected partition, press D. The following list shows the existing partitions and unpartitioned space on this computer. Use the UP and DOWN ARROW keys to select an item in the list.  To set up Windows 2000 on the selected item, press ENTER.  To create a partition in the unpartitioned space, press C.  To delete the selected partition, press D. You asked Setup to delete the partition %1 on %2.  To delete this partition, press L. CAUTION: All data on this partition will be lost.  To return to the previous screen without deleting the partition, press ESC. You asked Setup to create a new partition on %1.  To create the new partition, enter a size below and press ENTER.  To go back to the previous screen without creating the partition, press ESC. The minimum size for the new partition is %2!5u! megabytes (MB). The maximum size for the new partition is %3!5u! megabytes (MB). Setup has determined that your computer's startup hard disk is new or has been erased, or that your computer is running an operating system that is incompatible with Windows 2000. If the hard disk is new or has been erased, or if you want to discard its current contents, you can choose to continue Setup. If your computer is running an operating system that is incompatible with Windows 2000, continuing Setup may damage or destroy the existing operating system.  To continue Setup, press C. CAUTION: Any data currently on your computer's startup hard disk will be lost.  To quit Setup, press F3. pThis portion of Setup has completed successfully. xWindows 2000 has not been installed on this computer. pThe following value in the .SIF file used by Setup is corrupted or missing: Value %1!u! on line %2!u! in section [%3] Setup cannot continue. To quit Setup, press F3. The following value in the .SIF file used by Setup is corrupted or missing: Value %1!u! on the line in section [%2] with key "%3." Setup cannot continue. To quit Setup, press F3. x+====================================================+ | Windows 2000 is not completely set up on your | | computer. If you quit Setup now, you will need | | to run Setup again to set up Windows 2000. | | | |  To continue Setup, press ENTER. | |  To quit Setup, press F3. | *----------------------------------------------------* | F3=Quit ENTER=Continue | +====================================================+ XThe partition or the unpartitioned space you selected is too small for Windows 2000. Select a partition or unpartitioned space of at least %1!u! megabytes (MB). Windows 2000 cannot recognize the partition you selected. Setup cannot install Windows 2000 on this partition. However, you can go back to the previous screen, delete the partition, and then select the resulting unpartitioned space. Setup will then create a new partition on which you can install Windows 2000. Windows 2000 recognizes the partition you selected, but the partition is unformatted or damaged. To install Windows 2000 on this partition, Setup must reformat it.  To continue Setup using the selected partition, press C. Setup will ask you again before reformatting the partition.  To select a different partition, press ESC. xThe partition you selected does not have enough free space for the installation of Windows 2000. Windows 2000 requires at least %1!u! megabytes (MB) of free disk space. To install Windows 2000 on this partition, Setup must reformat it.  To continue Setup using the selected partition, press C. Setup will ask you again before reformatting the partition.  To select a different partition, press ESC. TSetup cannot create a new partition in the space you selected because the maximum number of partitions already exists on the disk. To continue, press ENTER. Line %1!u! of %2 is corrupted. Setup cannot continue. To quit Setup, press F3. To install Windows 2000 on the partition you selected, Setup must write some startup files to the following disk: %1 However, this disk does not contain a Windows 2000-compatible partition. To continue installing Windows 2000, return to the partition selection screen and create a Windows 2000-compatible partition on the disk above. If there is no free space on the disk, delete an existing partition, and then create a new one. To return to the partition selection screen, press ENTER. Setup has found Boot Manager software on your computer and must temporarily disable the software to set up Windows 2000. After Setup is complete, you can enable the Boot Manager by using the Disk Management tool in Windows 2000 to mark the Boot Manager partition as active. Refer to your Windows 2000 documentation for more information about Disk Management. The active partition on your computer contains another operating system. To successfully complete the installation of Windows 2000, Setup must mark this partition inactive. If the other operating system does not support dual-booting with Windows 2000, you can use Disk Management (part of Computer Management, in the Administrative Tools folder) to mark its partition active when Setup is complete. However, doing this may affect your ability to start Windows 2000. ,Drive %1 is unformatted, damaged, or formatted with a file system that is incompatible with Windows 2000. To continue installing Windows 2000, Setup needs to format this drive.  To format the drive and continue Setup, press F. CAUTION: All data currently on the drive will be lost.  To return to the previous screen without formatting the drive, press ESC. Drive %2 does not have enough free disk space to contain Windows 2000 startup files. You must have at least %1!u! kilobytes (KB) of free disk space on this drive to install Windows 2000. To continue installing Windows 2000, Setup must format the drive.  To format the drive and continue Setup, press F. CAUTION: All data currently on the drive will be lost.  To return to the previous screen without formatting the drive, press ESC. A new partition for Windows 2000 has been created on %1. This partition must now be formatted. From the list below, select a file system for the new partition. Use the UP and DOWN ARROW keys to select the file system you want, and then press ENTER. If you want to select a different partition for Windows 2000, press ESC. You have asked to install Windows 2000 on the partition %1 on %2. This partition is either too full, damaged, not formatted, or formatted with an incompatible file system. To continue installing, Setup must format this partition. CAUTION: Formatting will delete any files on the partition. Use the UP and DOWN ARROW keys to select the file system you want, and then press ENTER. If you want to select a different partition for Windows 2000, press ESC. The partition you selected is not formatted. Setup will now format the partition. Use the UP and DOWN ARROW keys to select the file system you want, and then press ENTER. If you want to select a different partition for Windows 2000, press ESC. Setup will install Windows 2000 on partition %1 on %2. Use the UP and DOWN ARROW keys to select the file system you want, and then press ENTER. If you want to select a different partition for Windows 2000, press ESC. ,CAUTION: Windows 2000 can use FAT or NTFS, but converting this drive to NTFS will make this drive unusable by other operating systems installed on this computer. Do not convert the drive to NTFS if you require access to the drive when using other operating systems such as MS-DOS, Windows, OS/2, or earlier versions of Windows NT. Confirm that you want to convert: %1 on %2.  To convert the drive to NTFS, press C.  To select a different partition for Windows 2000, press ESC. CAUTION: Formatting this drive will delete all files on it. Confirm that you want to format: %1 on %2.  To format the drive, press F.  To select a different partition for Windows 2000, press ESC. Please wait while Setup formats the partition %1 on %2. 4Setup was unable to format the partition. The disk may be damaged. Make sure the drive is switched on and properly connected to your computer. If the disk is a SCSI disk, make sure your SCSI devices are properly terminated. Consult your computer manual or SCSI adapter documentation for more information. You must select a different partition for Windows 2000. To continue, press ENTER. Setup will now format drive %1. To continue, press ENTER. ,You asked Setup to delete Windows system files from the following folder. Confirm that you want to delete: %1 CAUTION: After deleting system files from a Windows installation you can no longer start that installation of Windows.  To delete Windows system files from the above folder, press R.  To go back to the previous screen without deleting any files, press ESC. Setup has finished deleting files. %1!u! bytes of disk space were freed. Please wait while Setup removes the Windows system files. LSetup cannot open the following log file: %1 Setup cannot delete the Windows system files from the selected installation. To continue, press ENTER. The partition you selected does not have enough free space for the installation of Windows 2000. Setup has found existing Windows installations in the following folders. Deleting one of them may free enough disk space for Setup to install Windows 2000 on the partition you selected. CAUTION: ALL files in a folder will be lost when the folder is deleted.  To select the Windows installation you want to delete, use the UP and DOWN ARROW keys, and then press ENTER.  If you want to format the partition you selected or you want to install Windows 2000 on a different partition, press ESC. An error occurred while Setup was updating partition information on: %1. Setup cannot continue. To quit Setup, press F3. The drive containing the earlier version of Windows is too full to hold Windows 2000. Setup has found existing Windows installations in the following folders. Deleting one of these installations may free enough disk space for Setup to continue. CAUTION: ALL files in a folder will be lost when the folder is deleted.  Use the UP and DOWN ARROW keys to select the Windows installation you want to remove, and then press ENTER.  If you want to install Windows 2000 on a different drive, press ESC or move the highlight to "Do not remove any files" and press ENTER. Setup found Microsoft Windows 3.0 or 3.1 or Windows for Workgroups 3.11 in the following folder: %1!c!:%2 Setup cannot install Windows 2000 because the drive is too full. Windows 2000 requires %3!u! megabytes (MB) of free disk space.  To install to Windows 2000 on this drive, press F3 to quit Setup. Delete any unneeded files from the drive, and then run Setup again.  To continue installing Windows 2000 to a different drive, press ENTER. Setup found Microsoft Windows 3.0 or 3.1 or Windows for Workgroups 3.11 in the following folder: %1!c!:%2 Setup can install Windows 2000 into this folder. If you install, you will have to specify new settings and reinstall your applications.  To install Windows 2000 into this directory, press ENTER. CAUTION: Do not select this option if you still need to use the older version of Microsoft Windows.  To select a different folder for Windows 2000, press N. Setup needs to copy Windows 2000 files onto your hard disk. Select the folder in which the files should be copied: PTo change the suggested location, press the BACKSPACE key to delete characters, and then type the name of the folder where you want to install Windows 2000. The folder name you typed is not valid. Make sure the folder name is not the root folder and does not contain any consecutive backslash characters. Also make sure the folder name follows the standard MS-DOS filename rules. To continue, press ENTER. Setup will prompt you to enter a different folder name. The folder you selected for Windows 2000 also contains an earlier version of Windows. Setup can upgrade the earlier version of Windows to Windows 2000. If you upgrade, Windows 2000 replaces the earlier version of Windows and program settings are automatically moved to Windows 2000.  UPGRADE: To upgrade, press U. Upgrading replaces your existing Windows installation.  To select a different folder for Windows 2000, press N. CAUTION: A %1 folder already exists that may contain a Windows installation. If you continue, the existing Windows installation will be overwritten. All files, subfolders, user accounts, applications, security and desktop settings for that Windows installation will be deleted. The "My Documents" folder will also be deleted.  To use the folder and delete the existing Windows installation in it, press L.  To use a different folder, press ESC.  To quit Setup, press F3. Setup is out of memory and cannot continue. To quit Setup, press F3. Setup has determined that your computer contains the following hardware and software components.  Computer: Display: Keyboard: Keyboard Layout: Pointing Device: No Changes: If you want to change any item in the list, press the UP or DOWN ARROW key to move the highlight to the item you want to change. Then press ENTER to see alternatives for that item. When all the items in the list are correct, move the highlight to "The above list matches my computer" and press ENTER. The unpartitioned space you selected is reserved for Windows 2000 partitioning information. To create a new partition, go back to the previous screen, and then select a different unpartitioned space. You have asked to change the type of computer to be installed.  To select a computer from the following list, use the UP or DOWN ARROW key to move the highlight to the computer type you want, and then press ENTER.  To return to the previous screen without changing your computer type, press ESC. <You have asked to change the type of display to be installed. WARNING: The list below is extremely limited and may not contain an item exactly corresponding to your display type. This is normal. Setup will allow further configuration of your display type later. Changing your display type now is neither recommended nor necessary unless you have a driver disk provided by a display adapter manufacturer.  To select a display from the following list, use the UP or DOWN ARROW key to move the highlight to the type you want, and then press ENTER.  To return to the previous screen without changing your display type, press ESC. You have asked to change the type of keyboard to be installed.  To select a keyboard from the following list, use the UP or DOWN ARROW key to move the highlight to the keyboard type you want, and then press ENTER.  To return to the previous screen without changing your keyboard type, press ESC. You have asked to change the type of keyboard layout to be installed.  To select a keyboard layout from the following list, use the UP or DOWN ARROW key to move the highlight to the keyboard layout type you want, and then press ENTER.  To return to the previous screen without changing your keyboard layout type, press ESC. You have asked to change the type of pointing device to be installed.  To select a pointing device from the following list, use the UP or DOWN ARROW key to move the highlight to the pointing device type you want, and then press ENTER.  To return to the previous screen without changing your pointing device type, press ESC. You have chosen to change your computer type to one supported by a disk provided by a hardware manufacturer.  To select a computer from the following list, use the UP or DOWN ARROW key to move the highlight to the computer type you want, and then press ENTER.  To return to the previous screen without changing your computer type, press ESC. You have chosen to install a display provided by a hardware manufacturer.  To select a display from the following list, use the UP or DOWN ARROW key to move the highlight to the display type you want, and then press ENTER.  To return to the previous screen without changing your display type, press ESC. You have chosen to install a keyboard provided by a hardware manufacturer.  To select a keyboard from the following list, use the UP or DOWN ARROW key to move the highlight to the keyboard type you want, and then press ENTER.  To return to the previous screen without changing your keyboard type, press ESC. You have chosen to install a keyboard layout provided by a hardware manufacturer.  To select a keyboard layout from the following list, use the UP or DOWN ARROW key to move the highlight to the keyboard layout type you want, and then press ENTER.  To return to the previous screen without changing your keyboard layout type, press ESC. You have chosen to install a pointing device provided by a hardware manufacturer.  To select a pointing device from the following list, use the UP or DOWN ARROW key to move the highlight to the pointing device type you want, and then press ENTER.  To return to the previous screen without changing your pointing device type, press ESC. Insert the disk labeled: %%I%1 into drive %2!c!:  Press ENTER when ready. Insert the CD labeled: %%I%1 into your CD-ROM drive.  Press ENTER when ready. pIf there is a floppy disk in drive A:, remove it. The disk or CD you inserted may be damaged. Press ENTER to try again. Make sure you are using the correct disk or CD. If you continue to see this message, try using a different copy of the disk or CD. Setup cannot install hardware components provided by a hardware manufacturer because there are no floppy disk drives in your computer. A problem exists with the .SIF file on the manufacturer- supplied disk: %1 Setup cannot use the disk or select an option. Contact the hardware manufacturer. To continue, press ENTER. Setup cannot continue until it knows the type of your computer. Setup cannot continue until it knows the type of your display. Setup cannot continue until it knows the type of your keyboard. Setup cannot continue until it knows your keyboard layout type. Setup cannot continue until it knows the type of your pointing device. Setup did not find any hard disk drives installed in your computer. Make sure any hard disk drives are powered on and properly connected to your computer, and that any disk-related hardware configuration is correct. This may involve running a manufacturer-supplied diagnostic or setup program. Setup cannot continue. To quit Setup, press F3. pSetup automatically detects floppy disk controllers and standard ESDI/IDE hard disks without user intervention. However on some computers detection of certain other mass storage devices, such as SCSI adapters and CD-ROM drives, can cause the computer to become unresponsive or to malfunction temporarily. For this reason, you can bypass Setup's mass storage device detection and manually select SCSI adapters, CD-ROM drives, and special disk controllers (such as drive arrays) for installation.  To continue, press ENTER. Setup will attempt to detect mass storage devices in your computer.  To skip mass storage device detection, press S. Setup will allow you to manually select SCSI adapters, CD-ROM drives, and special disk controllers for installation. Setup has recognized the following mass storage devices in your computer: |  To specify additional SCSI adapters, CD-ROM drives, or special disk controllers for use with Windows 2000, including those for which you have a device support disk from a mass storage device manufacturer, press S.  If you do not have any device support disks from a mass storage device manufacturer, or do not want to specify additional mass storage devices for use with Windows 2000, press ENTER. You have asked to specify an additional SCSI adapter, CD-ROM drive, or special disk controller for use with Windows 2000.  To select a mass storage device from the following list, use the UP or DOWN ARROW key to move the highlight to the mass storage device you want, and then press ENTER.  To return to the previous screen without specifying an additional mass storage device for use with Windows 2000, press ESC. pYou have chosen to install a SCSI adapter, CD-ROM drive, or special disk controller provided by a hardware manufacturer.  To select a mass storage device from the following list, use the UP or DOWN ARROW key to move the highlight to the mass storage device you want, and then press ENTER.  To return to the previous screen without specifying a mass storage device for use with Windows 2000, press ESC. The SCSI adapter, CD-ROM drive, or special disk controller you specified is not installed in your computer. dSetup cannot create the folder: %1 Setup cannot continue until the folder is created.  To retry, press ENTER.  To quit Setup, press F3. Setup cannot copy the file: %1  To retry, press ENTER. If you are installing from a CD, make sure the Windows 2000 CD is in the CD-ROM drive.  To skip this file, press ESC. CAUTION: If you skip this file, Setup may not complete and Windows 2000 may not work properly.  To quit Setup, press F3. <The file %1 was not copied correctly. The file Setup placed on your hard drive is not a valid Windows 2000 system image. If you are installing from a CD, there may be a problem with the Windows 2000 CD.  To retry, press ENTER. If you continue to receive this message, contact your Windows 2000 supplier or system administrator.  To skip this file, press ESC. CAUTION: If you skip this file, Setup may not complete and Windows 2000 may not work properly.  To quit Setup, press F3. Please wait while Setup copies files to the Windows 2000 installation folders. This may take several minutes to complete. <Setup cannot set the required Windows 2000 configuration information. This indicates an internal Setup error. Contact your system administrator. Please wait while Setup initializes your Windows 2000 configuration. Setup cannot configure your computer to start Windows 2000. There may be a problem with the hard disk containing drive %1, or %2: may be corrupted. Setup cannot continue. To quit Setup, press F3. Setup cannot add a new entry to your computer's list of available operating systems because your computer's configuration memory may be full. Setup will continue, but you should run the system configuration program supplied by your computer manufacturer to update the startup configuration. You'll need the following information: LOADIDENTIFIER = %1 OSLOADER = %2 OSLOADPARTITION = %3 OSLOADFILENAME = %4 OSLOADOPTIONS = %5 SYSTEMPARTITION = %6 Setup cannot locate the Windows installation you want to upgrade. Contact your system administrator. An Undelete program is in use on your computer. This program uses a portion of your hard disk to keep track of deleted files. Disk space used to keep track of deleted files is not recognized as free disk space by Windows 2000. For this reason, the amount of free disk space reported by Setup and Windows 2000 may differ from the amount reported by MS-DOS. `Setup cannot initialize the device name database, possibly because of an internal Setup error or a system problem. Setup cannot continue. To quit Setup, press F3. The partition you tried to delete is a system partition. System partitions may contain diagnostic or hardware configuration programs, programs to start operating systems (such as Windows 2000), or other manufacturer-supplied programs. Delete a system partition only if you are sure that it contains no such programs or if you are willing to lose them. Deleting a system partition may prevent your computer from starting from the hard disk until you complete installation of Windows 2000.  To delete this partition, press ENTER. Setup will prompt you for confirmation before deleting the partition.  To go back to the previous screen without deleting the partition, press ESC. You chose to install Windows 2000 on the system partition. A system partition is a special area of the hard disk that your computer uses to store operating system startup files and diagnostic, configuration, or other manufacturer-supplied programs. Your computer requires that system partitions be formatted with the FAT file system. You cannot convert or format the system partition NTFS. As a result, you won't be able to use the full security features of Windows 2000.  To select a different partition for Windows 2000, press ESC.  To install Windows 2000 on the system partition, press ENTER. Either no valid system partitions are defined on this computer, or all system partitions are full. Windows 2000 requires %1!u! kilobytes (KB) of free disk space on a valid system partition. A system partition is an area of a hard disk that your computer uses to store operating system startup files and diagnostic, configuration, or other manufacturer-supplied programs. System partitions are created and managed by a manufacturer-supplied configuration program. You can also use a program called Arcinst.exe, which is available on the Windows 2000 CD. How you start this program depends on your computer type. Usually, you select the "Run a program" option from your computer's startup menu. Setup cannot continue. To quit Setup, press F3. (There is a syntax error in the .SIF file that Setup uses at line: %1!u!. Setup cannot continue. Shut down or restart your computer. \Remove any CDs from your CD-ROM drive. Setup cannot find the temporary installation files. The hard drive on which Setup placed temporary files is not currently available to Windows 2000. You may need a manufacturer-supplied device driver, or you may need to run Setup again and select a drive that is compatible with Windows 2000 for the temporary installation files. See your Windows 2000 documentation for more information. On x86-based computers, floppy disks generated by Setup for use with non-CD installations are not suitable for installing from CD. Setup cannot continue. To quit, press F3. CAUTION: If you continue upgrading to Windows 2000, your previous Windows installation will be deleted.  To continue upgrading to Windows 2000, press U.  To quit Setup, press F3. Insert your Automated System Recovery Disk into drive A:  Press ENTER when done. This computer does not have enough memory to run Windows 2000. This version requires %1!u!.%2!02u! megabytes (MB) of memory (RAM). Setup cannot continue. To quit Setup, press F3. Your computer's startup program cannot gain access to the disk containing the partition or free space you chose. Setup cannot install Windows 2000 on this hard disk. This lack of access does not necessarily indicate an error condition. For example, disks attached to a SCSI adapter that wasn't installed by your computer manufacturer or to a secondary hard disk controller, are typically not visible to the startup program unless special software is used. Contact your computer or hard disk controller manufacturer for more information. On x86-based computers, this message may indicate a problem with the CMOS drive type settings. See your disk controller documentation for more information. Press ENTER to continue. Windows 2000 cannot be installed on a disk connected to a PC card. Select a different disk. Press ENTER to continue. The Emergency Repair information on the disk you provided or the Windows 2000 installation you specified is not valid: %1 Setup cannot use the information to repair the selected Windows 2000 installation.  To provide a different Emergency Repair disk or to specify a different Windows 2000 installation, press ENTER.  To quit Setup, press F3. (The Emergency Repair information on the disk you provided or the Windows 2000 installation you specified is not valid: %1 Setup cannot repair the file.  To skip this file, press ENTER. The file will not be repaired.  To quit Setup, press F3.  %1  To skip this file, press ESC. The file will not be repaired.  To repair this file, press ENTER.  To repair this file and all other files not originally installed with Windows 2000, press A.  To quit Setup, press F3. Please wait while Setup examines files on your hard disk. HSetup has completed repairs. TWindows 2000 has not been repaired. \To restart your computer, press ENTER. pWhen your computer restarts, Setup will continue. You need an Emergency Repair disk for the Windows 2000 installation you want to repair. NOTE: Setup can only repair Windows 2000 installations.  If you have the Emergency Repair disk, press ENTER.  If you do not have the Emergency Repair disk, press L. Setup will attempt to locate Windows 2000 for you. Setup cannot find a CD-ROM drive. Make sure your CD-ROM drive is on and properly connected to your computer. If it is a SCSI CD-ROM drive, make sure your SCSI devices are properly terminated. See your computer or SCSI adapter documentation for more information. Setup cannot continue. To quit Setup, press F3. Setup cannot find a Windows 2000 installation to repair. Unless you provide the Emergency Repair disk for the installation you want to repair, Setup cannot make the repairs.  If you have the Emergency Repair Disk, or if you want Setup to search for existing Windows 2000 installations again, press ENTER.  If you want to quit Setup, press F3. The hard disk containing the partition or free space you chose has a Logical Unit Number (LUN) greater than 0. Therefore, your computer's startup program cannot gain access to the disk. Setup cannot install Windows 2000 on this disk. Contact your computer or hard disk controller manufacturer for more information. Press ENTER to continue. Setup has encountered an error and cannot continue. Contact technical support for assistance. The following status codes will assist them in diagnosing the problem: (%1!#lx!, %2!#lx!, %3!#lx!, %4!#lx!) Setup is out of memory and cannot continue. Shut down or restart your computer. 8Setup encountered an error while initializing your computer's video. Contact technical support for assistance. The following status codes will assist them in diagnosing the problem: (%1!#lx!, %2!#lx!) Setup cannot continue. Shut down or restart your computer. Setup cannot continue. Shut down or restart your computer. lSetup cannot continue. To quit Setup, press F3. The following value in the .SIF file that Setup uses is corrupted or missing: Value %1!u! on line %2!u! in section [%3] Setup was unable to copy the file %4.  To skip this file, press ESC. CAUTION: If you skip this file, Setup may not complete and Windows 2000 may not work properly.  To quit Setup, press F3. The following value in the .SIF file that Setup uses is corrupted or missing: Value %1!u! on the line in section [%2] with key "%3." Setup was unable to copy the file %4.  To skip this file, press ESC. CAUTION: If you skip this file, Setup may not complete and Windows 2000 may not work properly.  To quit Setup, press F3. hThe partition you have chosen is too full to contain Windows 2000, which requires a drive with at least %1!u! megabytes (MB) of free disk space. Go back to the previous screen and select a different partition on which to install.  To go back to the previous screen, press ENTER. (Drive %2 does not have enough space for the Windows 2000 startup files. You must have at least %1!u! kilobytes (KB) of free disk space on this drive to install Windows 2000. Quit Setup and free some space on this drive.  To quit Setup, press F3. Setup was unable to format drive %1. The hard disk may be damaged. Make sure the disk is on and properly connected to your computer. If the disk is a SCSI disk, make sure your SCSI devices are properly terminated. See your computer or SCSI adapter documentation for more information. Setup cannot continue. To quit Setup, press F3. Because this partition is larger than 2048 megabytes (MB), Setup will format it with the FAT32 file system. Files stored on this partition will not be available when you are using other operating systems, such as MS-DOS or some versions of Windows.  To continue and format the partition, press ENTER.  To go back to the previous screen without having Setup formatting this partition, press ESC.  To quit Setup, press F3. Because drive %1 is larger than 2048 megabytes (MB), Setup will format the drive with the FAT32 file system. Files stored on the drive will not be available when using other operating systems, such as MS-DOS or some versions of Microsoft Windows.  To continue and format the drive, press ENTER.  To go back to the previous screen without having Setup formatting this partition, press ESC.  To quit Setup, press F3. Setup has found an existing Windows installation in the folder selected for the installation of Windows 2000. You must select a different folder for Windows 2000. To continue, press ENTER. Setup will prompt you to select a different folder. 4There is not enough space on the drive containing the existing Windows installation for Windows 2000. Setup has found Windows installations in the following folders. Deleting one of the installations may free enough disk space for Setup to install Windows 2000.  Use the UP and DOWN ARROW keys to select the Windows installation you want to delete, and then press ENTER.  If you want to install Windows 2000 on a different drive, press ESC or select "Do not remove any files" and press ENTER. LSetup has found an earlier version of Windows in the following folder: %1!c!:%2 Setup can install Windows 2000 in this directory and preserve your Windows 95 settings and installed applications. However the drive is too full to hold Windows 2000, which requires %3!u! megabytes (1 MB = 1,048,576 bytes) of free disk space. NOTE: Installing Windows 2000 in this directory removes Windows 95.  To install Windows 2000 in the directory above, press F3 to quit Setup. Start Windows 95,delete any unneeded files from the drive and then run Setup again.  To select a different directory for Windows 2000, press N. 8Setup has found Microsoft Windows 95 on your hard disk. Setup can replace Windows 95 with Windows 2000, preserving your compatible settings and applications, or setup can install Windows 2000 independent of Windows 95. --------------------------------------------------------- The migration option is not yet available; press Enter. ---------------------------------------------------------  To install Windows 2000 and preserve Windows 95 settings, press F3 to exit, start Windows 95, and run Windows 2000 setup.  To install Windows 2000 and disregard any Windows 95 settings, press Enter. PSetup has found Microsoft Windows 95 in the directory you chose for Windows 2000. Setup can install Windows 2000 in this directory and preserve your Windows 95 settings and installed applications. NOTE: Installing Windows 2000 in this directory removes Windows 95.  To install Windows 2000 in the same directory, press ENTER.  To select a different directory for Windows 2000, press ESC. 0The manufacturer provided file that Setup is trying to use is corrupted or invalid: %1 Setup cannot continue. To quit Setup, press F3. \The following value specified in the Setup answer file is not defined in the .SIF file, section [%2]: %1 Setup cannot continue. To quit Setup, press F3. The disk you selected is a removable drive that is already partitioned. Windows 2000 does not support creation of multiple partitions on a removable drive. You can select another disk, or you can delete the partitions that already exist and then create a new partition. To go back to the partition selection screen, press ENTER. 4There is not enough disk space to repair the Windows 2000 installation you selected. Drive Space Required(KB) Free Space Available(KB) -------- ------------------ ------------------------ %4 %5 %6 %7 %8 %9  If you want to upgrade, press F3 to quit Setup. Delete any unneeded files to create the required free space and then start Setup again.  To go back to the previous screen, press ENTER. There is not enough disk space to upgrade the following Windows 2000 installation: %1:%2 %3 Drive Space Required(KB) Free Space Available(KB) -------- ------------------ ------------------------ %4 %5 %6 %7 %8 %9 Setup cannot continue.  Press F3 to quit Setup. Delete any unneeded files to create the required free space and then start Setup again. Setup has already attempted to upgrade the following Windows installation. %1:%2 %3 Setup will try to complete the upgrade again.  To retry upgrading to Windows 2000, press ENTER.  To quit Setup, press F3. If one of the following Windows 2000 installations is damaged, Setup can try to repair it. Use the UP and DOWN ARROW keys to select an installation.  To repair the selected Windows 2000 installation, press R.  To continue installing a fresh copy of Windows 2000 without repairing, press ESC. Setup cannot delete the file: %1. This error will not prevent Setup from completing successfully.  To skip deleting this file, press ESC (recommended).  To retry deleting this file, press ENTER.  To quit Setup, press F3. Setup cannot back up the file %1 to %2. This error will not prevent Setup from completing successfully.  To skip backing up this file, press ESC (recommended).  To retry backing up this file, press ENTER.  To quit Setup, press F3. Setup cannot copy the following key into your registry: %1\%2 Without this key, Setup may not be able to upgrade your installation properly. Retry this operation and if it continues to fail, press F3 to quit Setup.  To retry copying the key, press ENTER.  To skip copying the key, press ESC.  To quit Setup, press F3. Setup has found Windows 2000 in the following folder: %1 %2  To repair this Windows 2000 installation, press ENTER.  To go back to the previous screen, press ESC.  To quit Setup, press F3. The following list shows the Windows 2000 installations on your computer that may be repaired. Use the UP and DOWN ARROW keys to select an item in the list.  To repair the selected Windows 2000 installation, press ENTER.  To go back to the previous screen, press ESC.  To quit Setup, press F3. As part of the repair process, Setup will perform each optional task selected below. To have Setup perform the selected tasks, press ENTER. To change the selections, use the UP or DOWN ARROW keys to select an item, and then press ENTER. Please wait while Setup inspects your Windows 2000 configuration. TSetup will restore each registry file selected below. To have Setup restore the selected files, press ENTER. To change a selection, use the UP or DOWN ARROW key to select the item, and then press ENTER. CAUTION: Restoring a registry file may delete the existing configuration. Setup cannot restore the registry. The Emergency Repair disk or the hard disk containing Windows 2000 may be damaged.  Press ENTER to continue the repair process.  To quit, press F3. The existing Windows 2000 installation is a Windows 2000 Professional. Upgrading will make it a Windows 2000 Server that cannot be a Primary or Backup Domain Controller.  To upgrade the Windows 2000 Professional to a Windows 2000 Server, press ENTER.  To cancel upgrade and install a new copy of Windows 2000 Server, press ESC. `The existing Windows 2000 installation you chose to upgrade is a Windows 2000 Professional. Upgrading will make it a Windows 2000 Server that cannot be a Primary or Backup Domain Controller.  To upgrade the Windows 2000 Professional to a Windows 2000 Server, press ENTER.  To select another installation to upgrade, or to install a new copy of Windows 2000 Server, press ESC. Setup did not find a keyboard connected to your computer. Setup cannot continue. Shut down your computer and check to make sure that the keyboard cable is properly connected. If the problem persists, your keyboard or computer may need repair. Setup cannot load the keyboard layout file %1. Setup cannot continue. Shut down or restart your computer. Please wait while Setup examines your disks. This may take several minutes depending on the size of the disks. Setup has determined that drive %1 is corrupted and cannot be repaired. Setup cannot continue. To quit Setup, press F3. tSetup will now examine your hard disk(s) for corruption. In addition to a basic examination, Setup can perform a more exhaustive secondary examination on some drives. This can be a time consuming operation, especially on large or very full drives.  To allow Setup to perform an exhaustive secondary examination of your hard disk(s), press ENTER.  To skip the exhaustive examination, press ESC. Setup was unable to verify drive %1. Your computer may not have enough memory to examine the drives, or your Windows 2000 CD may contain some corrupted files. To continue, press ENTER. 0Setup will now examine your computer's drives. Setup needs the original installation files. If you do not have them, you may skip the drive examination.  To have Setup examine the drives, press ENTER.  To skip the drive examination, press ESC. Setup has performed maintenance on your hard disk. You must restart your computer to continue with Setup. LSetup cannot find a previous version of Windows installed on your computer. To continue, Setup needs to verify that you qualify to use this upgrade product. Please insert your Windows NT 3.51 Workstation, Windows NT 4.0 Workstation, Windows 95, or Windows 98 CD into your CD-ROM drive. Please insert your Windows NT 3.51 or Windows NT 4.0 Server CD into your CD-ROM drive.   When the CD is in the drive, press ENTER.  To quit Setup, press F3. Setup could not read the CD you inserted, or the CD is not from Windows NT 3.51 or Windows NT 4.0. \No previous version of Windows NT can be found on your computer. Setup cannot verify that you qualify to install this upgrade product. To quit Setup, press F3. Please insert your Windows NT 4.0 Server, Enterprise Edition CD into your CD-ROM drive. Setup cannot format your drive %1. Setup cannot continue. To quit Setup, press F3. Setup cannot format the partition. Your computer may not have enough memory to perform this operation, or your Windows 2000 CD-ROM may contain some corrupted files. Setup cannot continue. To quit Setup, press F3. ,Setup has determined that the following file did not come from Microsoft: %1 This file may have been provided by your hardware manufacturer. Setup can replace this file with the latest Microsoft version, or it can continue the installation without replacing this file.  To allow Setup to replace the file, press ENTER.  To keep the original file, press ESC. The partition you selected cannot be deleted. Setup cannot read licensing data. Setup cannot continue. To quit Setup, press F3. 8Setup cannot access the CD containing the Windows 2000 installation files. To retry, press ENTER. If you are not successful after several tries, quit Setup. Then, to restart Setup, copy the Windows 2000 installation files to your hard disk. To quit Setup, press F3. Setup cannot find the End User Licensing Agreement (EULA). Setup cannot continue. To quit, press F3. TSetup is deleting old cached files. XSetup has detected one or more older versions of Windows NT on this computer. These versions will not start unless they are upgraded to Windows NT 4.0 with Service Pack 4 or greater before you install Windows 2000. To continue, press C. To quit Setup, press F3. pPlease wait while Setup deletes temporary files. xSetup is deleting the existing Windows installation.  %1 The disk may be damaged or not properly initialized. To continue installing Windows 2000, Setup must initialize the disk.  To initialize the disk, press I. CAUTION: All data on the disk will be lost.  To go back to the previous screen without initializing the disk, press ESC. Setup has completed disk initialization. To continue with Setup, you must shut down your computer and restart Setup. Make sure that the Windows 2000 Setup Boot Disk is in drive A before you restart.  To restart, press F3. Setup has determined that the BIOS on your computer must be updated before you can install Windows 2000. Contact your computer manufacturer for more information.  To quit Setup, press F3. The partition you attempted to delete is on a dynamic disk. Deletion of this partition will make all other partitions on this disk unusable. Do not delete this partition if you need to keep any of the data on any of the partitions on this disk.  To delete this partition, press ENTER. Setup will prompt you for confirmation before deleting the partition.  To go back to the previous screen without deleting the partition, press ESC. (You asked Setup to delete the partition: %1 on %2. CAUTION: This partition contains %3!u! compressed drive(s). Deleting this partition will also delete its compressed drive(s).  To delete this partition, press L. CAUTION: ALL data on the partition will be lost.  To go back to the previous screen without deleting the partition, press ESC. CAUTION: This partition contains %3!u! compressed drive(s). Formatting this drive will erase all data currently stored on it, including its compressed drive(s). Confirm that you want to format %1 on %2.  To format the drive, press F.  To select a different partition for Windows 2000, press ESC. TCAUTION: This partition contains %3!u! compressed drive(s). Converting this partition to NTFS will make the partition and its compressed drive(s) inaccessable to operating systems other than Windows 2000. If you need access to the drive when using other operating systems, such as MS-DOS, Windows, or OS/2, do not convert the drive to NTFS. Confirm that you want to convert: %1 on %2.  To convert the partition to NTFS, press C.  To select a different partition for Windows 2000, press ESC. CAUTION: The selected operating system image cannot be modified to match your computer's hardware because a matching version of Windows 2000 could not be found. The image may work if your hardware is similar to the hardware in use when the image was created.  To continue installing, press C.  To quit Setup, press F3. CAUTION: The selected operating system image cannot be modified to match your computer's hardware because of a missing driver or lack of resources. The image may work if your hardware is similar to the hardware in use when the image was created.  To continue installing, press C.  To quit Setup, press F3. Setup encountered error %1!#lx! while copying %2 from the operating system image. The image may work if the file or directory is not critical.  To continue installing, press C.  To quit Setup, press F3. Setup cannot copy the operating system image you selected. %1 Contact your system administrator. Setup cannot set permissions for %1.  To skip this file, press ESC. CAUTION: If you choose to skip this file, Setup may not complete or Windows 2000 may not function properly.  To quit Setup, press F3. You chose to install Windows 2000 on a partition that contains another operating system. Installing Windows 2000 on this partition might cause the other operating system to function improperly.  To continue Setup using this partition, press C.  To select a different partition, press ESC. F3=Quit%0 ,ENTER=Continue%0 0ESC=More Options%0 4ENTER=Express Setup%0 ,C=Custom Setup%0 4C=Create Partition%0 4D=Delete Partition%0 (ENTER=Install%0 L=Delete%0 $F3=Restart%0 $ESC=Cancel%0 (ENTER=Create%0 0C=Continue Setup%0 <ENTER=Restart Computer%0 F=Format%0 C=Convert%0 LExamining disk configuration...%0 (ENTER=Select%0 ,R=Remove Files%0 Removing:%0 ,Updating %1...%0 lSearching for versions of Microsoft Windows...%0 4N=Different Folder%0 ,Examining %1...%0 8ESC=Different Folder%0 ,Please wait...%0 0S=Skip Detection%0 HLoading device driver (%1)...%0 DS=Specify Additional Device%0 8Creating folder %1...%0 $ENTER=Retry%0 (ESC=Skip File%0 \Creating list of files to be copied...%0 Copying:%0 LLoading information file %1...%0 PLoading default configuration...%0 <Saving configuration...%0 HInitializing configuration...%0 PSetting startup configuration...%0 LUpdating startup environment...%0 <Restarting computer...%0 LProcessing information file...%0 dInitializing SCSI startup configuration...%0 XPreparing to upgrade font file %1...%0 DExamining configuration...%0 0I=Initialize Disk%0 |Searching for previous versions of Microsoft Windows...%0 PExamining startup environment...%0 4Deleting file %1...%0 PUpdating startup configuration...%0 (ENTER=Upgrade%0 $O=Overwrite%0 DBacking up file %1 to %2...%0 4ESC=Skip Operation%0 0ESC=Don't Repair%0 ,ENTER=Next Page%0 <BACKSPACE=Previous Page%0 ,ESC=Cancel Help%0 XLoading Keyboard Layout library %1...%0 R=Repair%0 (ENTER=Repair%0 ,Examining %1...%0 0Repairing %1 ...%0 (A=Repair All%0 8ENTER=Select/Deselect%0 4D=Disaster Recovery%0 ,M=Manual Repair%0 (F=Fast Repair%0 4Shut Down Computer%0 8Checking drive %1...%0 HSetup is examining folders...%0 4ENTER=Replace File%0 U=Upgrade%0 $F8=I agree%0 4ESC=I do not agree%0 4PAGE DOWN=Next Page%0 8PAGE UP=Previous Page%0 |Searching for previous versions of Microsoft Windows...%0 %%ISetup Notification: Setup program has detected that you are about to install an Evaluation version of Microsoft(R) Windows(R) 2000 operating system which contains a time limited expiration for evaluation purposes only.  To continue, press ENTER.  To quit Setup without installing Windows 2000, press F3. L=Locate%0 C=Console%0 4%%ISetup Notification: Setup has detected that your system partition is invalid. You may reconfigure your disk partitions now or exit Setup.  To return to the disk partitioning menu, press ENTER.  To quit Setup without installing Windows 2000, press F3. LWindows 2000 Professional Setup%0 @Windows 2000 Server Setup%0 $Setup Help%0 PWindows 2000 Licensing Agreement%0 (Unknown Disk%0 P%1!u! MB Disk on unknown adapter%0 P(Setup cannot access this disk.)%0 d%1 %2!-35.35s!%3!5u! MB ( %4!5u! MB free)%0 d%1 %2!-35.35s!%3!5u! MB ( %4!5u! KB free)%0 @%1 %2!-35.35s!%3!5u! MB%0 p Unpartitioned space %1!5u! MB%0 PCreate partition of size (in MB):%0 <Setup is formatting...%0 DSetup is deleting files...%0 P(There is no disk in this drive.)%0 lFormat the partition using the FAT file system%0 lFormat the partition using the NTFS file system%0 HConvert the partition to NTFS%0 pLeave the current file system intact (no changes)%0 <Do not delete any files%0 <none> %0 The operating system image is imcompatible with this version of Windows 2000. This computer does not have enough disk partitions for the selected image. This computer does not have enough disk partitions for the selected image. This computer does not have enough disk space on the selected partition. DCannot set permissions on %1. dCannot read image configuration file from %1 This computer is multiprocessor-enabled but the image is from a uniprocessor-enabled computer. This computer is uniprocessor-enabled but the image is from a multiprocessor-enabled computer. tThis computer uses a different HAL than the computer from which the image was created. The signature of the original HAL is: %1 The signature of this computer's HAL is: %2 0NTLDR is missing%0 $Disk error%0 @Press any key to restart%0 0NTLDR is missing%0 4NTLDR is compressed%0 DA disk read error occurred%0 HPress Ctrl+Alt+Del to restart%0 <Invalid partition table%0 LError loading operating system%0 @Missing operating system%0 XENIX%0 0OS/2 Boot Manager%0 ,EISA Utilities%0 Unix%0 HWindows 2000 Fault Tolerance%0 $XENIX Table%0 ,System Reserved%0 EZDrive%0 Unknown%0 FAT32%0 $PowerQuest%0 HInactive (OS/2 Boot Manager)%0 8OnTrack Disk Manager%0 (Windows 2000%0 XUnknown device (migrated driver: %1)%0 <Unformatted or Damaged%0 0New (Unformatted)%0 FAT%0 NTFS%0 FAT32%0 NTFS%0 Unknown%0 TThe above list matches my computer.%0 Other (Requires disk provided by a hardware manufacturer)%0 dManufacturer-supplied hardware support disk%0 DSetup cannot load the file. The disk contains no support files for the component you are attempting to change. `Syntax error on line %2!u! in section %1 HSection %1 missing or empty. Unknown file type specified on line %2!u! in section %1. Bad source disk specified on line %2!u! in section %1. Unknown registry value type specified on line %2!u! in section %1. Badly formed registry data on line %2!u! in section %1. Missing <configname> (field 3) on line %2!u! in section %1. Illegal or missing file types specified in section %1. TLine %2!u! contains a syntax error. (More )%0 (More )%0 Found: %1%0 @Setup is copying files...%0 dUnidentified operating system on drive %1.%0 HInstall Windows 2000 from CD%0 TWindows 2000 Emergency Repair Disk%0 PSetup cannot find or load the file. PLine %2!u! contains a syntax error. Incorrect or missing signature in the Repair Information File. Setup cannot load the source file %1 or the source file is not the original one Setup copied to the Windows 2000 installation. Setup has determined that the file: %1 is not the original file that Setup copied to the Windows 2000 installation. \The file is not the Windows 2000 version. DSetup is examining files...%0 DRepair Windows 2000 from CD%0 TWindows 2000 Emergency Repair Disk%0 L[X] Inspect startup environment%0 X[X] Verify Windows 2000 system files%0 <[X] Inspect boot sector%0 X Continue (perform selected tasks)%0 P[ ] SYSTEM (System Configuration)%0 T[ ] SOFTWARE (Software Information)%0 T[ ] DEFAULT (Default User Profile)%0 P[ ] NTUSER.DAT (New User Profile)%0 T[ ] SECURITY (Security Policy) and%0 P SAM (User Accounts Database)%0 (Mirror)%0 pSection [%1] does not contain the description %3 dWindows 2000 Automated System Recovery Disk%0 Setup cannot process the configuration file on the Automated System Recovery Disk. Check that the Dr_state.sif file is present and readable. Automated System Recovery cannot continue. To exit, press F3. $Setup cannot process the configuration file on the Automated System Recovery Disk because one or more required sections are missing. Check that the Dr_state.sif file contains the required sections. Automated System Recovery cannot continue. To exit, press F3. @Setup cannot process the configuration file on the Automated System Recovery Disk because one or more required records are missing. Check that all sections in the Dr_state.sif file contain the required records. Automated System Recovery cannot continue. To exit, press F3. hSetup cannot process the configuration file on the Automated System Recovery Disk because one or more required configuration attributes are missing. Check that all records in the Dr_state.sif file contain the required attributes. Automated System Recovery cannot continue. To exit, press F3. The file system on one of the system partitions is not supported. Automated System Recovery cannot continue. To exit, press F3. The file system specified for the Windows 2000 partition is unknown. Check the partition section of the Dr_state.sif file on the Automated System Recovery Disk. Automated System Recovery cannot continue. To exit, press F3. The file system specified for the Loader partition is unknown. Check the partition section of the Dr_state.sif file on the Automated System Recovery Disk. Automated System Recovery cannot continue. To exit, press F3. lThe capacity of the replacement storage is insufficient and cannot be used to recover the original system. Automated System Recovery cannot continue. To exit, press F3. tThe configuration of the replacement storage is incompatible with the system's orginal storage configuration. Automated System Recovery cannot continue. To exit, press F3. lAutomated System Recovery encountered an internal inconsistency (%1) and cannot continue. Please contact your support representative for assistance. To exit, press F3. Please wait while the Emergency Repair Process examines files on your hard disk. |Emergency Repair Process cannot find the Setup.log file on the ER disk and cannot continue. Correct the problem and then run the Emergency Repair Proces again. To exit, press F3. One or more partitions on one or more of your hard drives must be recreated and reformatted. Warning: All data on partitions other than the Windows 2000 partition will be deleted, and only the data present in the Automated System Recovery saveset will be restored. Data on other partitions must be restored from backups after Automated System Recovery is complete. Do you want to continue recreating the partitions?  To continue, press Enter.  To quit, press F3. xThe following error condition occurred during Automated System Recovery: Module %1, line %2!u!: %3 Contact the ASR development team for assistance. To exit, press F3. \Automated System Recovery (ASR) disk maintenance requires that you restart your computer before system recovery can finish. When the Welcome screen reappears, select the same ASR options you chose originally. ASR will then continue system recovery.  To restart the computer, press F3. Windows 2000 Repair Options:  To repair a Windows 2000 installation by using the recovery console, press C.  To repair a Windows 2000 installation by using the emergency repair process, press R. If the repair options do not successfully repair your system, run Windows 2000 Setup again. This operation will attempt to repair your Windows 2000 system. Depending on the type of damage present, this operation may or may not be successful. If the system is not successfully repaired, restart Setup and choose the option to recover a destroyed system or system disk. Select one of the following repair options.  Manual Repair: To choose from a list of repair options, press M.  Fast Repair: To perform all repair options, press F. HEmergency Repair cannot continue. The Emergency Repair procedure cannot repair this Windows 2000 system, because the Windows 2000 partition has been recreated and/or reformatted by the Automated System Recovery procedure, and the files on the partition are no longer intact. DSetup is deleting files...%0 dYour computer will reboot in %%d seconds...%0 TAutomated System Recovery encountered an error due to an incorrect format in the ASR setup file. Automated System Recovery cannot continue. To exit, press F3. Automated System Recovery encountered an error due to an incorrect format in the ASR setup file. No records in section: %1 Automated System Recovery cannot continue. To exit, press F3. Automated System Recovery encountered an error due to incorrect data in the ASR setup file. NULL value found in section: %1 Automated System Recovery cannot continue. To exit, press F3. Automated System Recovery encountered an error due to an invalid record in the ASR setup file: Section: %1 Value: %2!u! Automated System Recovery cannot continue. To exit, press F3. Automated System Recovery encountered an error due to an invalid record in the ASR setup file: Section: %1 Value: %2 Automated System Recovery cannot continue. To exit, press F3. (Automated System Recovery (ASR) did not find a specified file on the ASR recovery disk. File: %1 You can continue the current ASR session, or you may exit ASR and rerun it later with a valid file.  To continue, press Enter  To exit, press F3 The capacity of the replacement storage is insufficient. Partitions for disk record: %1 could not be assigned. Automated System Recovery cannot continue. To exit, press F3. The configuration of the replacement storage is incompatible with the system's orginal storage configuration. Partitions for the following disk record cannot be assigned. %1 Automated System Recovery cannot continue. To exit, press F3. Automated System Recovery encountered an I/O error on device: %1 Automated System Recovery cannot continue. To exit, press F3. Automated System Recovery encountered an I/O error on file: %1 Automated System Recovery cannot continue. To exit, press F3. @Automated System Recovery encountered an I/O error on disk %1!u!, Start Sector %2!u!. Automated System Recovery cannot continue. To exit, press F3. LAutomated System Recovery encountered an error creating partition %1 at Start Sector %2!u!. Automated System Recovery cannot continue. To exit, press F3. lAutomated System Recovery encountered an error in one or more records of the Setup.log file on the ASR disk. Automated System Recovery cannot continue. To exit, press F3. |Setup cannot process the configuration file on the Automated System Recovery Disk due to an error at line %1!u!. Automated System Recovery cannot continue. To exit, press F3. Setup cannot process the configuration file on the Automated System Recovery Disk. Check that the Dr_state.sif file is present, readable, and correctly formatted. Automated System Recovery cannot continue. To exit, press F3. ,Setup cannot process the configuration file on the Automated System Recovery Disk, due to the following error: No partition record in the state file is flagged as the Windows 2000 partition. Automated System Recovery cannot continue. To exit, press F3. DSetup cannot process the configuration file on the Automated System Recovery Disk, due to the following error: More than one partition record in the state file is flagged as the Windows 2000 partition. Automated System Recovery cannot continue. To exit, press F3. Setup cannot process the configuration file on the Automated System Recovery Disk, due to the following error: No partition record in the state file is flagged as the previous system's partition containing the Windows 2000 startup files. Automated System Recovery cannot continue. To exit, press F3. Setup cannot process the configuration file on the Automated System Recovery Disk, due to the following error: More than one partition record in the state file is flagged as the previous system's partition containing the Windows 2000 startup files. Automated System Recovery cannot continue. To exit, press F3. Automated System Recovery cannot restore your system to its original state due to insufficient disk capacity. Automated System Recovery can partially recreate the Windows 2000 system by performing the following steps: All partitions on the disks containing the Windows 2000 partition and the partition containing the Windows 2000 startup files will be restored. Do you want to continue?  To continue, press ENTER.  To exit, press F3. pAutomated System Recovery cannot restore your system to its original state due to insufficient disk capacity. Automated System Recovery can partially recreate the Windows 2000 system by performing the following steps: The Windows 2000 partition and the partition containing the Windows 2000 startup files will be restored. Do you want to continue?  To continue, press ENTER.  To exit, press F3. LAutomated System Recovery cannot restore your system to its original state due to insufficient disk capacity. Automated System Recovery can partially recreate the Windows 2000 system by performing the following steps: The Windows 2000 partition and the partition containing the Windows 2000 startup files will be restored. These partitions were previously on separate disk drives, and will be combined onto a single drive. Do you want to continue?  To continue, press ENTER.  To exit, press F3. XAutomated System Recovery cannot restore your system to its original state due to insufficient disk capacity. Automated System Recovery can partially recreate the Windows 2000 system by performing the following steps: The Windows 2000 partition will be restored. The Windows 2000 partition and the partition containing the Windows 2000 boot files were previously separate partitions, and will be combined into a single partition. Do you want to continue?  To continue, press ENTER.  To exit, press F3. <*CCDCFCRNSSLORAUDILFMC%0 # 0: (reserved) # 1: C=Custom Setup (10005) # 2: C=Create Partition (10006) # 3: D=Delete Partition (10007) # 4: C=Continue Setup (10013) # 5: F=Format (10015) # 6: C=Convert (10016) # 7: R=Remove Files (10019) # 8: N=Different Directory (10023) # 9: S=Skip Detection (10027) #10: S=Specify Additional SCSI Adapter (10029) #11: L=Delete (10009) #12: O=Overwrite (10065) #13: R=Repair (10073) #14: A=Repair All (10077) #15: U=Upgrade (10087) #16: D=Disaster Recovery (10079) #17: I=Initialize Disk (10047) <SP_SCRN_LOCALE_SPECIFIC_1 <SP_SCRN_LOCALE_SPECIFIC_2 <SP_SCRN_LOCALE_SPECIFIC_3 <SP_SCRN_LOCALE_SPECIFIC_4 <SP_SCRN_LOCALE_SPECIFIC_5 <SP_SCRN_LOCALE_SPECIFIC_6 <SP_SCRN_LOCALE_SPECIFIC_7 <SP_SCRN_LOCALE_SPECIFIC_8 <SP_SCRN_LOCALE_SPECIFIC_9 @SP_SCRN_LOCALE_SPECIFIC_10 4VS_VERSION_INFOWW? StringFileInfo040904B0LCompanyNameMicrosoft Corporation>FileDescriptionWindows NT Setup (user mode portion of character-based phase)8 FileVersion5.00.2135.16 InternalNameUSETUP.EXEt(LegalCopyrightCopyright (C) Microsoft Corp. 1981-1999> OriginalFilenameUSETUP.EXE~/ProductNameMicrosoft(R) Windows (R) 2000 Operating System< ProductVersion5.00.2135.1DVarFileInfo$Translation N1V1111111122!2(22282@2L2222223 3>3F3M333333344(4J4x4444444445 55A5P5[5e5l5y555555555556%6,636;6B6J6Q6Y6a6s66666 777*7.72767:7>7B7F7J7N7R7V7Z7^7r777777778D8S8`8m8s8}8888888888979999::exe\usetup.dbg.exe